DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43776 and pi15

DIOPT Version :9

Sequence 1:NP_001261162.1 Gene:CG43776 / 14462630 FlyBaseID:FBgn0264298 Length:270 Species:Drosophila melanogaster
Sequence 2:XP_002937120.1 Gene:pi15 / 100489915 XenbaseID:XB-GENE-989406 Length:258 Species:Xenopus tropicalis


Alignment Length:251 Identity:56/251 - (22%)
Similarity:99/251 - (39%) Gaps:80/251 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 TRYHAIVPD---------IPKLR-------TEILRIINNFRNQFASGAFRTSENRTFTQAKRMRQ 99
            :.|..|.||         :||.|       .:::.|: .:.||.        ..:.|..|..|..
 Frog    35 SNYTIIKPDLSARLDAAKVPKARRKRYISQNDMIAIV-EYHNQV--------RGKVFPPAANMEY 90

  Fly   100 ILWDSELAYMARSHASTVSFQHTKCRSTVRFPRVGECLAMMVPKYKHTVHEALKKMFKIMFDEHL 164
            ::||..||.:|.:.|:|..:.|.. ...::|  :|:.|::...:||     ::.::.|..:||  
 Frog    91 MVWDENLAKLAEAWAATCIWDHGP-SYLLKF--LGQNLSVRTGRYK-----SILQLVKPWYDE-- 145

  Fly   165 HIQD----------PRGLLQGFHPIRDYVSSHFTIIVSDRVSRVGCGVAVGTNCRQGSSSNFCH- 218
             ::|          ||..|:.:.|    :.:|:|.:|....:|:||.:            :.|| 
 Frog   146 -VKDYAFPYPQECNPRCPLRCYGP----MCTHYTQMVWATTNRIGCAI------------HTCHN 193

  Fly   219 ------------FLTC-YFDYDNVNGSYVYKAGKPASSC-SDWGTTKSKEFANLCY 260
                        :|.| |....|..|...|..|.|.|:| ..:|.:.|.   |.|:
 Frog   194 MNVWGAVWRRAVYLVCNYSPKGNWIGEAPYTIGVPCSACPPSYGGSCSD---NQCF 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43776NP_001261162.1 SCP_euk 64..225 CDD:240180 39/191 (20%)
pi15XP_002937120.1 CAP_PI15 67..212 CDD:349408 37/180 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.