DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43776 and crisp1.6

DIOPT Version :9

Sequence 1:NP_001261162.1 Gene:CG43776 / 14462630 FlyBaseID:FBgn0264298 Length:270 Species:Drosophila melanogaster
Sequence 2:XP_002933627.1 Gene:crisp1.6 / 100379939 XenbaseID:XB-GENE-5838744 Length:237 Species:Xenopus tropicalis


Alignment Length:167 Identity:38/167 - (22%)
Similarity:65/167 - (38%) Gaps:29/167 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 FRTSENRTFTQAKRMRQILWDSELAYMARSHASTVSFQHT-KCRSTVRFPRVGECLAMMVPKYKH 146
            :|.|.|   ..|:.|.:::|....|..|.:.::|....|: ..:.|:.....||  .:.:..|..
 Frog    44 YRRSVN---PSARNMLKMMWSEAAASNAATWSATCPAAHSPTSQRTISGVTCGE--NIFIASYPA 103

  Fly   147 TVHEALKKMFKIMFDEHLHIQDPRGLLQGFHPI-RDYVSSHFTIIVSDRVSRVGCGVAVGTNCRQ 210
            :..||:    .....|..:.|      .|..|. .:.|:.|:|.:|......|||.|   :||  
 Frog   104 SWQEAI----TAWNSESQYFQ------YGVGPTSSNQVTGHYTQLVWYNSYMVGCAV---SNC-- 153

  Fly   211 GSSSNFCHFLTCYF--DYDNVNG-SYVYKAGKPASSC 244
                |..:...|.:  ..:|:|. :..||:|.....|
 Frog   154 ----NNQYIYVCQYCPMGNNLNTITTPYKSGPACGDC 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43776NP_001261162.1 SCP_euk 64..225 CDD:240180 32/145 (22%)
crisp1.6XP_002933627.1 CAP_CRISP 32..166 CDD:349402 32/145 (22%)
Crisp 183..236 CDD:369954 1/4 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.