DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43776 and crispld1a

DIOPT Version :9

Sequence 1:NP_001261162.1 Gene:CG43776 / 14462630 FlyBaseID:FBgn0264298 Length:270 Species:Drosophila melanogaster
Sequence 2:XP_001920421.2 Gene:crispld1a / 100149104 ZFINID:ZDB-GENE-090612-1 Length:508 Species:Danio rerio


Alignment Length:230 Identity:51/230 - (22%)
Similarity:77/230 - (33%) Gaps:89/230 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 ILRIINNFRNQFASGAFRTSENRTFTQAKRMRQILWDSELAYMARSHASTVSFQHTKCRSTVRFP 131
            ||.:.|..|.|            .:..|..|..::||:||...|...|.|..::|....   ..|
Zfish    70 ILDLHNKLRGQ------------VYPPASNMEYMVWDNELERSAEEWAETCLWEHGPAG---LLP 119

  Fly   132 RVGECLAMMVPKYK-HTVHEALKKMFKIMFDEHLHIQDPRGLLQGFHPIRDY------------- 182
            ::|:.|.:...:|: .|.|      .:..:||                ::||             
Zfish   120 QIGQNLGVHWGRYRPPTSH------VQAWYDE----------------VKDYSFPYPQECNPHCP 162

  Fly   183 ------VSSHFTIIVSDRVSRVGCGVAVGTNCRQGSSSNFCH-------------FLTC-YFDYD 227
                  |.:|:|.:|....||:||.:            |.|:             :|.| |....
Zfish   163 FRCSGPVCTHYTQLVWATSSRIGCAI------------NVCYNMNVWGQIWAKAVYLVCNYSPKG 215

  Fly   228 NVNGSYVYKAGKPASSC--SDWGTTKSKEFANLCY 260
            |..|...||.|...|:|  |..|..:.    ||||
Zfish   216 NWWGYAPYKHGTSCSACPPSYGGVCRE----NLCY 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43776NP_001261162.1 SCP_euk 64..225 CDD:240180 38/191 (20%)
crispld1aXP_001920421.2 SCP_euk 68..212 CDD:240180 37/190 (19%)
LCCL 298..381 CDD:128866
LCCL 401..500 CDD:281766
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170585689
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.