DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43776 and XB5812873

DIOPT Version :9

Sequence 1:NP_001261162.1 Gene:CG43776 / 14462630 FlyBaseID:FBgn0264298 Length:270 Species:Drosophila melanogaster
Sequence 2:XP_031758624.1 Gene:XB5812873 / 100127722 XenbaseID:XB-GENE-5812874 Length:272 Species:Xenopus tropicalis


Alignment Length:194 Identity:46/194 - (23%)
Similarity:73/194 - (37%) Gaps:53/194 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 AKRMRQILWDSELAYMARSHASTVSFQHTKCRSTVRFPRVGECLA---MMVPKYKHTVHEALKKM 155
            |..|.::.||:.....|:..|.|.||:|    |.:.|.:.|...|   :|...::|    :.:.:
 Frog    85 AADMLKMHWDNYYLAKAKEWALTCSFKH----SNLSFRQYGGEFAGENIMNSYFRH----SWEYV 141

  Fly   156 FKIMFDEHLHIQDPRGLLQGFHPIRDYVSSHFTIIVSDRVSRVGCGVAVGTNCRQGSSSNFCHFL 220
            ....|:||::.:...|..:     ...|:.|||.|:......:.|.||   .| .|:..|:  |.
 Frog   142 INYWFNEHVNWEYAVGTTK-----EGAVTGHFTQIIWAPTHALACYVA---KC-YGTPYNY--FY 195

  Fly   221 TC-YFDYDN---------VNGSYVYKAGKPASSCSD---------------WGTTKSKEFANLC 259
            .| |:...|         .||:   ..|.....|.|               .||.|:   |:||
 Frog   196 VCIYYPTGNREDKVKTPYQNGT---TCGLCQKDCDDQLCLNYCPYYNSAGNCGTDKN---ASLC 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43776NP_001261162.1 SCP_euk 64..225 CDD:240180 34/134 (25%)
XB5812873XP_031758624.1 CAP 65..201 CDD:412178 34/134 (25%)
Crisp 219..269 CDD:400739 9/38 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.