DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43776 and R3hdml

DIOPT Version :9

Sequence 1:NP_001261162.1 Gene:CG43776 / 14462630 FlyBaseID:FBgn0264298 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001092801.1 Gene:R3hdml / 100043899 MGIID:3650937 Length:253 Species:Mus musculus


Alignment Length:195 Identity:48/195 - (24%)
Similarity:84/195 - (43%) Gaps:45/195 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 AKRMRQILWDSELAYMARSHASTVSFQHTKCRSTVRFPRVGECLAMMVPKYKHTVHEALKKMFKI 158
            |..|..::||.:||..|.:.|:...:.|...: .:::  ||:.|::...:::..|     .:.:.
Mouse    81 AANMEYMVWDEQLARSAEAWATQCIWTHGPSQ-LMKY--VGQNLSIHSGRFRSVV-----DLVRS 137

  Fly   159 MFDEHLHIQDPR---------GLLQGFHPIRDYVSSHFTIIVSDRVSRVGCGVAVGTNCRQ---- 210
            ..:|..|...|.         .|..|  |    |.||:|.:|....||:||.:   ..|..    
Mouse   138 WSEEKRHYSFPAPKDCTPHCPWLCSG--P----VCSHYTQMVWASSSRLGCAI---NTCSSINVW 193

  Fly   211 GSSSNFCHFLTCYFDYDNVNGSYV----YKAGKPASSC--SDWGTTKSKEFANLCYN--NGNLIP 267
            |::.....:|.|.:   .:.|:::    ||||||.|:|  |..|...|    |:|::  ..|.:|
Mouse   194 GNTWQQAVYLVCNY---AIKGNWIGEAPYKAGKPCSACPPSYQGNCNS----NMCFSGLKSNRLP 251

  Fly   268  267
            Mouse   252  251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43776NP_001261162.1 SCP_euk 64..225 CDD:240180 32/143 (22%)
R3hdmlNP_001092801.1 CAP_R3HDML 63..208 CDD:349409 32/146 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167841255
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.