DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43668 and Lamp3

DIOPT Version :10

Sequence 1:NP_001261110.1 Gene:CG43668 / 14462617 FlyBaseID:FBgn0263743 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_796330.2 Gene:Lamp3 / 239739 MGIID:2441659 Length:411 Species:Mus musculus


Alignment Length:97 Identity:17/97 - (17%)
Similarity:31/97 - (31%) Gaps:34/97 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 IGLALLLQANTIAGQDYQVFGSPGVQVIYPSSSQVQVIGGRHFLRNGLRRNLTINANATSQNFQL 70
            :||||::|...:.....:.|.      |.||.:..                   :....||...|
Mouse   237 MGLALIVQEKDLDSATQRYFN------IDPSLTHA-------------------SGKCDSQKSNL 276

  Fly    71 ISSLSNGNSGNTPLRNFLRSLFGRQPNIQYVN 102
            ..:...|:...|         |.::.|:.|::
Mouse   277 FLNFQGGSVNIT---------FTKEENLYYIS 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43668NP_001261110.1 None
Lamp3NP_796330.2 DUF5585 <76..>210 CDD:465521
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 172..204
Lamp 218..361 CDD:460152 17/97 (18%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.