DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43666 and CG43667

DIOPT Version :9

Sequence 1:NP_001261107.1 Gene:CG43666 / 14462614 FlyBaseID:FBgn0263741 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_001261108.1 Gene:CG43667 / 14462615 FlyBaseID:FBgn0263742 Length:207 Species:Drosophila melanogaster


Alignment Length:215 Identity:50/215 - (23%)
Similarity:75/215 - (34%) Gaps:59/215 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 YLASLNNNNNNQVTSTTAAP-----DTTSSTSTTSTANPTSTATPTTSTAI---PTS---TGSPT 149
            :||:.::.|:.|....||.|     ..:::........|.......|::||   |.|   ..|..
  Fly    16 HLANASDMNSGQEQIRTAIPWLYILALSAAQPHIPILRPQDETPANTNSAIMKKPQSDEIVNSDQ 80

  Fly   150 TSTAVATQ--------STTTASPTTSTAVATSDGSDTTSTAVATQTTTTASPTTSTAVAPADTDT 206
            ::..|..|        .....|||.|.||        .|..:|..||||..|........:|.|.
  Fly    81 SNNEVREQFLQGILLGLQQPGSPTISPAV--------LSDFIAQATTTTRKPAVQKDADGSDNDE 137

  Fly   207 TSTAV---QNARIQTTPLPYRYVHSSLVNPYDLHRISS--NQIYVRGSAVASADAQSEPV--YIP 264
            ....:   ..:||:                |||..:..  |:|..|.:...:|:.|..|.  |.|
  Fly   138 DVDYIDFKNGSRIK----------------YDLDDVEQPVNKILQRTTKRPAANPQQNPALYYRP 186

  Fly   265 ------YQNIYRRAQPSPYF 278
                  |:.||   .|:||:
  Fly   187 PTSTVYYRPIY---GPTPYY 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43666NP_001261107.1 None
CG43667NP_001261108.1 IsdH_HarA <50..>186 CDD:132697 36/159 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438669
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.