DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rgk1 and RAS1

DIOPT Version :9

Sequence 1:NP_725875.3 Gene:Rgk1 / 14462605 FlyBaseID:FBgn0264753 Length:1379 Species:Drosophila melanogaster
Sequence 2:NP_014744.1 Gene:RAS1 / 854268 SGDID:S000005627 Length:309 Species:Saccharomyces cerevisiae


Alignment Length:255 Identity:68/255 - (26%)
Similarity:109/255 - (42%) Gaps:52/255 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly  1121 YRVLMLGGPAVGKSSLVSQFMTSEYLHAYDTSIDDESGEKA-----VSVL----LSGEESELIFI 1176
            |:::::||..||||:|..||:.|.::..||.:|:|...::.     ||:|    .:|:|.     
Yeast    11 YKIVVVGGGGVGKSALTIQFIQSYFVDEYDPTIEDSYRKQVVIDDKVSILDILDTAGQEE----- 70

  Fly  1177 DHGYTEMTPDECLTNYDPHGYCVIYSAADRSSFSVAEQVLQVLWTNQNIAQK---AVILVSNKAD 1238
               |:.|......|.   .|:.::||...|:||   :::|......|.:...   .|::|.||.|
Yeast    71 ---YSAMREQYMRTG---EGFLLVYSVTSRNSF---DELLSYYQQIQRVKDSDYIPVVVVGNKLD 126

  Fly  1239 LARSRLVTSEEGKAMATAYDCKFIETSVGINHNVDELLVGLLSQIR----------LKLENPEKS 1293
            |...|.|:.|:|..:|...:..|:|||.....||||....|:..:|          .:|:|..:.
Yeast   127 LENERQVSYEDGLRLAKQLNAPFLETSAKQAINVDEAFYSLIRLVRDDGGKYNSMNRQLDNTNEI 191

  Fly  1294 RDLFRKRSI---RKSKRRACSPLNAGCLNANTPLGPLGEAVATPPGSAQSSPRKYRGSRT 1350
            ||.....|.   |:.|......|:....||.|             ||:..|...:.|..|
Yeast   192 RDSELTSSATADREKKNNGSYVLDNSLTNAGT-------------GSSSKSAVNHNGETT 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rgk1NP_725875.3 DUF2967 459..715 CDD:288079
P-loop_NTPase 1121..1379 CDD:304359 68/255 (27%)
small_GTPase 1121..1286 CDD:197466 52/186 (28%)
RAS1NP_014744.1 small_GTPase 9..172 CDD:197466 51/174 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.