DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rgk1 and RABA1f

DIOPT Version :9

Sequence 1:NP_725875.3 Gene:Rgk1 / 14462605 FlyBaseID:FBgn0264753 Length:1379 Species:Drosophila melanogaster
Sequence 2:NP_200894.1 Gene:RABA1f / 836207 AraportID:AT5G60860 Length:217 Species:Arabidopsis thaliana


Alignment Length:185 Identity:47/185 - (25%)
Similarity:79/185 - (42%) Gaps:46/185 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly  1121 YRVLMLGGPAVGKSSLVSQFMTSEY----------------LHAYD----TSIDDESGEKAVSVL 1165
            ::|:::|...||||:|:|:|..:|:                :|..|    ..|.|.:|::....:
plant    14 FKVVLIGDSGVGKSNLLSRFTRNEFSLESKSTIGVEFATRSIHVDDKIVKAQIWDTAGQERYRAI 78

  Fly  1166 LSGEESELIFIDHGYTEMTPDECLTNYDPHGYCVIYSAADRSSFSVAEQVLQVL--WTNQNIAQK 1228
            .|......:                     |..::|......:|...|:.|:.|  .|:.||   
plant    79 TSAYYRGAV---------------------GALLVYDVTRHVTFENVERWLKELRDHTDANI--- 119

  Fly  1229 AVILVSNKADLARSRLVTSEEGKAMATAYDCKFIETSVGINHNVDELLVGLLSQI 1283
            .::.|.|||||...|.|::|:.||.|...:..|:|||...:.||:.....:||||
plant   120 VIMFVGNKADLRHLRAVSTEDAKAFAERENTFFMETSALESMNVENAFTEVLSQI 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rgk1NP_725875.3 DUF2967 459..715 CDD:288079
P-loop_NTPase 1121..1379 CDD:304359 47/185 (25%)
small_GTPase 1121..1286 CDD:197466 47/185 (25%)
RABA1fNP_200894.1 Rab11_like 11..175 CDD:206660 47/185 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.