DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rgk1 and Rrad

DIOPT Version :9

Sequence 1:NP_725875.3 Gene:Rgk1 / 14462605 FlyBaseID:FBgn0264753 Length:1379 Species:Drosophila melanogaster
Sequence 2:NP_445790.2 Gene:Rrad / 83521 RGDID:69357 Length:307 Species:Rattus norvegicus


Alignment Length:384 Identity:112/384 - (29%)
Similarity:158/384 - (41%) Gaps:106/384 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly  1015 GSRASGRPNQLCLPQQRSRVASMPNTGVEEEYYRLRHFSITGKGVVNRGDSLKSRRSRSNNSVAS 1079
            |||::||        :|.|.......|.....:| |...:         |....:.:.:..|:|:
  Rat    11 GSRSAGR--------ERDRRRGSTPWGPAPPLHR-RSMPV---------DERDLQAALTPGSLAA 57

  Fly  1080 SNSSTEHLTTQQQLSAPASVSARTSLASSRESSTSNPGNGPYRVLMLGGPAVGKSSLVSQFMTSE 1144
            :.:.|.  |..|:|..|...|      .|..|..|...:|.|:||:||.|.||||:|...|...|
  Rat    58 TAAGTR--TQGQRLDWPEGSS------DSLSSGDSGSEDGVYKVLLLGAPGVGKSALARIFGGIE 114

  Fly  1145 -------YLHAYDTSIDDESGEKAVSVLLSGEESELIFIDHGYTE---MTPDECLTNYDPHGYCV 1199
                   ..|.||.||           .:.|||:.|:..|....:   ..|..|:...|  .|.:
  Rat   115 DGPEAEAAGHTYDRSI-----------TVDGEEASLMVYDIWEQDGGCWLPGHCMAMGD--AYVI 166

  Fly  1200 IYSAADRSSFSVAEQVLQVLWTNQNIAQKAVILVSNKADLARSRLVTSEEGKAMATAYDCKFIET 1264
            :||..|:.||..|.::...|...:......:|||.||:||.|||.|:.:||:|.|..:|||||||
  Rat   167 VYSITDKGSFEKASELRVQLRRARQTDNVPIILVGNKSDLVRSREVSVDEGRACAVVFDCKFIET 231

  Fly  1265 SVGINHNVDELLVGLLSQIRLKLENPEKSRDLFRKRSIRKSKRRACSPLNAGCLNANTPLGPLGE 1329
            |..::|||..|..|::.||||:       ||                                  
  Rat   232 SAALHHNVQALFEGVVRQIRLR-------RD---------------------------------- 255

  Fly  1330 AVATPPGSAQSSPRKYRGSRTSTSL--KVKGLLGRVWTRDS-------KSKSCENLHVL 1379
                   |.:.:.|:..|:|...||  |.|..|||:..|:|       |||||.:|.||
  Rat   256 -------SKEDNARRQAGTRRRESLGKKAKRFLGRIVARNSRKMAFRAKSKSCHDLSVL 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rgk1NP_725875.3 DUF2967 459..715 CDD:288079
P-loop_NTPase 1121..1379 CDD:304359 87/276 (32%)
small_GTPase 1121..1286 CDD:197466 65/174 (37%)
RradNP_445790.2 RGK 91..307 CDD:206715 87/276 (32%)
RAS 91..251 CDD:214541 63/172 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D301527at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8910
orthoMCL 1 0.900 - - OOG6_109169
Panther 1 1.100 - - O PTHR45775
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X743
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.