DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rgk1 and gem

DIOPT Version :9

Sequence 1:NP_725875.3 Gene:Rgk1 / 14462605 FlyBaseID:FBgn0264753 Length:1379 Species:Drosophila melanogaster
Sequence 2:NP_001039314.1 Gene:gem / 560566 ZFINID:ZDB-GENE-060825-251 Length:291 Species:Danio rerio


Alignment Length:312 Identity:93/312 - (29%)
Similarity:147/312 - (47%) Gaps:58/312 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly  1034 VASMPNTGVEEEYYRLRHFSITGKGVVNRGDSLKSRRSRSNNSVASSNSSTEHLTTQQQLSAPAS 1098
            :||:....:..::: |..:||.|   .:.|..|.....||:.|::.|:|.:              
Zfish     4 LASVRRHSIRVQHH-LHRWSICG---TDGGQLLNDAFPRSDISMSRSSSCS-------------- 50

  Fly  1099 VSARTSLASSRESSTSNPGN-GPYRVLMLGGPAVGKSSLVSQF------MTSEYLHAYDTSIDDE 1156
             ||.:..|.|.||:|  |.: ||:.|::||...||||:|.|.|      |.|| ...|...|.::
Zfish    51 -SASSDSALSTESAT--PASVGPFTVVLLGDNGVGKSALASIFAGASDSMGSE-CELYGGEIFEQ 111

  Fly  1157 S----GEKAVSVLLSGEESELIFIDHGYTEMTPDECLTNYDPHGYCVIYSAADRSSFSVAEQVLQ 1217
            :    ||:|...||...:|:    |.|  ..|...||...|  .:.::|:..|||||..|..:..
Zfish   112 TITVDGERASVTLLDTWDSQ----DEG--SWTQQRCLQTGD--AFIIVYAITDRSSFLRASDLRV 168

  Fly  1218 VLWTNQNIAQKAVILVSNKADLARSRLVTSEEGKAMATAYDCKFIETSVGINHNVDELLVGLLSQ 1282
            .|...:.:.:..:|||.||.||.|.|.|:..||::.|..:||||||||..:.|||..|..|::.|
Zfish   169 QLRREREVDRTPIILVGNKCDLVRCREVSISEGRSSAAVFDCKFIETSAAMQHNVWPLFEGIIRQ 233

  Fly  1283 IRLKLEN-----------------PEKSRDLFRKRSIRKSKRRACSPLNAGC 1317
            :||:.::                 |:|::....:...:|:|:.|....:..|
Zfish   234 LRLRRDSMETLSSHSSLQKRRESLPKKAKRFINRMVAKKNKQAAFKLKSKSC 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rgk1NP_725875.3 DUF2967 459..715 CDD:288079
P-loop_NTPase 1121..1379 CDD:304359 70/224 (31%)
small_GTPase 1121..1286 CDD:197466 63/174 (36%)
gemNP_001039314.1 RGK 71..291 CDD:206715 70/224 (31%)
small_GTPase 73..237 CDD:197466 63/172 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D301527at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45775
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.