DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rgk1 and Ras85D

DIOPT Version :9

Sequence 1:NP_725875.3 Gene:Rgk1 / 14462605 FlyBaseID:FBgn0264753 Length:1379 Species:Drosophila melanogaster
Sequence 2:NP_476699.1 Gene:Ras85D / 41140 FlyBaseID:FBgn0003205 Length:189 Species:Drosophila melanogaster


Alignment Length:196 Identity:55/196 - (28%)
Similarity:96/196 - (48%) Gaps:24/196 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly  1121 YRVLMLGGPAVGKSSLVSQFMTSEYLHAYDTSIDDESGEKAVSVLLSGEESELIFID----HGYT 1181
            |:::::|...||||:|..|.:.:.::..||.:|:|...::   |::.||...|..:|    ..|:
  Fly     4 YKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQ---VVIDGETCLLDILDTAGQEEYS 65

  Fly  1182 EMTPDECLTNYDPHGYCVIYSAADRSSF----SVAEQVLQVLWTNQNIAQKAVILVSNKADLARS 1242
            .|......|.   .|:.::::.....||    :..||:.:|    ::..:..::||.||.||| |
  Fly    66 AMRDQYMRTG---EGFLLVFAVNSAKSFEDIGTYREQIKRV----KDAEEVPMVLVGNKCDLA-S 122

  Fly  1243 RLVTSEEGKAMATAYDCKFIETSVGINHNVDELLVGLLSQIRLKLENPEKSRDLFRKRSIRKSKR 1307
            ..|.:|:.:.:|..|...:||||......||:....|:.:||...:|  |.|   |.|.:.|..|
  Fly   123 WNVNNEQAREVAKQYGIPYIETSAKTRMGVDDAFYTLVREIRKDKDN--KGR---RGRKMNKPNR 182

  Fly  1308 R 1308
            |
  Fly   183 R 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rgk1NP_725875.3 DUF2967 459..715 CDD:288079
P-loop_NTPase 1121..1379 CDD:304359 55/196 (28%)
small_GTPase 1121..1286 CDD:197466 47/172 (27%)
Ras85DNP_476699.1 H_N_K_Ras_like 3..164 CDD:133338 45/170 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.