DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rgk1 and rem1

DIOPT Version :9

Sequence 1:NP_725875.3 Gene:Rgk1 / 14462605 FlyBaseID:FBgn0264753 Length:1379 Species:Drosophila melanogaster
Sequence 2:NP_957468.1 Gene:rem1 / 394149 ZFINID:ZDB-GENE-040317-1 Length:298 Species:Danio rerio


Alignment Length:335 Identity:105/335 - (31%)
Similarity:160/335 - (47%) Gaps:75/335 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly  1070 RSRSNNSVASS--------NSSTE--HLTTQQQLS---APASVSARTSLASSRESSTSNPGNGPY 1121
            |.|::..:.||        :.||:  |....|..|   ...|:.:|.:.:|..||.:|. ....|
Zfish    14 RRRASTPIPSSRQAGRGDRDPSTDPYHPPLAQSASYHPGDKSIHSRANWSSDSESDSSG-SECLY 77

  Fly  1122 RVLMLGGPAVGKSSLVSQFMTSEYLHAYDTSIDDESGEKAVSVLLSGEESELIFIDHGYTEMTPD 1186
            ||::||...||||||.:.|...:...|: ..|.:::.|:  ::::.||::.|:.:|...|:...|
Zfish    78 RVVLLGDHGVGKSSLANIFAGIQEKDAH-KHIGEDAYER--TLMVDGEDTTLVVMDPWETDKQED 139

  Fly  1187 E--CLTNY---DPHGYCVIYSAADRSSFSVAEQV---LQVLWTNQNIAQKAVILVSNKADLARSR 1243
            :  .|.:|   ..:.|.::||..|||||..|.::   |:.:...:||   .:|||.||:||.|||
Zfish   140 DEKFLQDYCMQVGNAYIIVYSITDRSSFESASELRIQLRRIRQAENI---PIILVGNKSDLVRSR 201

  Fly  1244 LVTSEEGKAMATAYDCKFIETSVGINHNVDELLVGLLSQIRLKLENP---EKSRDLF-RKRSIRK 1304
            .|..|||:|.|..:||||||||..::|||.||..|.:.||||:.::.   |:.|.:: ||.||.|
Zfish   202 EVAVEEGRACAVMFDCKFIETSASLHHNVHELFEGTVRQIRLRRDSKEINERRRSVYKRKESITK 266

  Fly  1305 SKRRACSPLNAGCLNANTPLGPLGEAVATPPGSAQSSPRKYRGSRTSTSLKVKGLLGRVWTRDSK 1369
            ..||....|.|                               .:....:|||            :
Zfish   267 KARRFLDRLVA-------------------------------KNNKKMALKV------------R 288

  Fly  1370 SKSCENLHVL 1379
            ||||.:|.||
Zfish   289 SKSCHDLAVL 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rgk1NP_725875.3 DUF2967 459..715 CDD:288079
P-loop_NTPase 1121..1379 CDD:304359 88/269 (33%)
small_GTPase 1121..1286 CDD:197466 68/172 (40%)
rem1NP_957468.1 RGK 77..298 CDD:206715 88/269 (33%)
small_GTPase 77..244 CDD:197466 68/172 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D301527at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45775
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5084
SonicParanoid 1 1.000 - - X743
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
66.050

Return to query results.
Submit another query.