DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rgk1 and Rem1

DIOPT Version :9

Sequence 1:NP_725875.3 Gene:Rgk1 / 14462605 FlyBaseID:FBgn0264753 Length:1379 Species:Drosophila melanogaster
Sequence 2:NP_001020924.1 Gene:Rem1 / 366232 RGDID:1306560 Length:297 Species:Rattus norvegicus


Alignment Length:337 Identity:107/337 - (31%)
Similarity:156/337 - (46%) Gaps:85/337 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly  1066 LKSRRSRSNNSVASSNSSTEHLTTQQQLSAPASVS---ARTSLASSRESSTSNPGNGP----YRV 1123
            |.||..:......:..:.::|    .:|...||::   .:.|.|....||.|:...|.    |||
  Rat    23 LSSRGHQPGRLCTAPPAQSQH----PRLGQSASLNPPIRKPSPAQDGWSSESSDSEGSWEALYRV 83

  Fly  1124 LMLGGPAVGKSSLVSQFMTSEYLHAYDTSIDDESG---EKAVSVLLSGEESELIFIDHGYTE--- 1182
            ::||.|.|||:||.|.|...:     :..:.::.|   |:.:||  .||::.|:.:|....|   
  Rat    84 VLLGDPGVGKTSLASLFAEKQ-----ERDLHEQLGGVYERTLSV--DGEDTTLVVMDTWEAEKLD 141

  Fly  1183 --MTPDECLTNYDPHGYCVIYSAADRSSF-SVAEQVLQVLWTNQNIAQKAVILVSNKADLARSRL 1244
              .:.:.||  .....|.::||.|||||| |.:|..:|:..|:| .|...:|||.|||||||.|.
  Rat   142 ESWSQESCL--QAGSAYVIVYSIADRSSFESASELRIQLRRTHQ-AAHVPIILVGNKADLARCRE 203

  Fly  1245 VTSEEGKAMATAYDCKFIETSVGINHNVDELLVGLLSQIRLKLENPEKSRDLFRKRSIRKSKRRA 1309
            |:.|||:|.|..:||||||||..:.|||.||..|::.|:||:.::                    
  Rat   204 VSVEEGRACAVVFDCKFIETSATLQHNVTELFEGVVRQLRLRRQD-------------------- 248

  Fly  1310 CSPLNAGCLNANTPLGPLGEAVATPPGSAQSSPRKYRGSRTSTSLKVKGLLGRVWTRD------- 1367
                     ||         |..||      |||:    |.|...:.:..|.|:..|.       
  Rat   249 ---------NA---------APETP------SPRR----RASLGQRARRFLARLTARSARRRALK 285

  Fly  1368 SKSKSCENLHVL 1379
            ::||||.||.||
  Rat   286 ARSKSCHNLAVL 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rgk1NP_725875.3 DUF2967 459..715 CDD:288079
P-loop_NTPase 1121..1379 CDD:304359 92/273 (34%)
small_GTPase 1121..1286 CDD:197466 72/173 (42%)
Rem1NP_001020924.1 RGK 81..297 CDD:206715 92/273 (34%)
small_GTPase 81..245 CDD:197466 72/173 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D301527at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8910
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45775
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X743
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
66.020

Return to query results.
Submit another query.