DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rgk1 and Gem

DIOPT Version :9

Sequence 1:NP_725875.3 Gene:Rgk1 / 14462605 FlyBaseID:FBgn0264753 Length:1379 Species:Drosophila melanogaster
Sequence 2:NP_001100107.1 Gene:Gem / 297902 RGDID:1307386 Length:295 Species:Rattus norvegicus


Alignment Length:320 Identity:95/320 - (29%)
Similarity:138/320 - (43%) Gaps:85/320 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly  1081 NSSTEHLTTQQQLSAPASVSARTSLASSRES-STSNPGNGPYRVLMLGGPAVGKSSLVSQFMTSE 1144
            |....|.|      ||.....|:..:.|.:| .:|..||..|||:::|...||||:|.:.|.   
  Rat    40 NPHNHHST------APDDHCRRSWSSESTDSVISSESGNTYYRVVLIGEQGVGKSTLANIFA--- 95

  Fly  1145 YLHAYDTSIDDES---GEKAV--SVLLSGEESELIFID----HGYTEMTPDECLTNYDPHGYCVI 1200
               ....|:|.:.   ||...  ::::.||.:.:|.:|    .|..|...|.|:...|  .|.::
  Rat    96 ---GVHDSMDSDCEVLGEDTYERTLVVDGESATIILLDMWENKGENEWLHDHCMQVGD--AYLIV 155

  Fly  1201 YSAADRSSFSVAEQVLQVLWTNQNIAQKAVILVSNKADLARSRLVTSEEGKAMATAYDCKFIETS 1265
            ||..||:||..|.::...|...:......:|||.||:||.|.|.|:..||:|.|..:||||||||
  Rat   156 YSITDRASFEKASELRIQLRRARQTEDIPIILVGNKSDLVRCREVSVSEGRACAVVFDCKFIETS 220

  Fly  1266 VGINHNVDELLVGLLSQIRLKLENPEKSRDLFRKRSIRKSKRRACSPLNAGCLNANTPLGPLGEA 1330
            ..:.|||.||..|::.|:||:.::.||:     :|.:...|||                      
  Rat   221 AAVQHNVKELFEGIVRQVRLRRDSKEKN-----ERRLAYQKRR---------------------- 258

  Fly  1331 VATPPGSAQSSPRKYRGSRTSTSLKVKGLLGRVWTR-----------DSKSKSCENLHVL 1379
                    :|.|||.|               |.|.:           ..|||||.:|.||
  Rat   259 --------ESIPRKAR---------------RFWGKIVAKNNKNMAFKLKSKSCHDLSVL 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rgk1NP_725875.3 DUF2967 459..715 CDD:288079
P-loop_NTPase 1121..1379 CDD:304359 82/277 (30%)
small_GTPase 1121..1286 CDD:197466 62/173 (36%)
GemNP_001100107.1 RGK 75..295 CDD:206715 82/277 (30%)
small_GTPase 75..241 CDD:197466 62/173 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D301527at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8910
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X743
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.