DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rgk1 and Y52B11A.4

DIOPT Version :9

Sequence 1:NP_725875.3 Gene:Rgk1 / 14462605 FlyBaseID:FBgn0264753 Length:1379 Species:Drosophila melanogaster
Sequence 2:NP_001379254.1 Gene:Y52B11A.4 / 173003 WormBaseID:WBGene00013124 Length:467 Species:Caenorhabditis elegans


Alignment Length:431 Identity:124/431 - (28%)
Similarity:193/431 - (44%) Gaps:76/431 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   971 QHKRDENMRQLLDVTNTLTIEELRDFQMRYGSPHHSRSQSVKM-----------------PGSRA 1018
            |.:.|...|:||...|.|.:.::|:      |...:||||.|.                 |..|.
 Worm    51 QLRTDSANRELLTGDNYLGVTDMRN------STTVARSQSFKHRPKPMVEVRRMAIDDVGPHERR 109

  Fly  1019 SGRPNQLCLPQ-QRSRVASMPNTGV------------------EEEYYRLRHFSITGKG-VVNRG 1063
            ...|.....|. |:||:.. |.|.|                  .|:|.|:|.|.|..|| ||:||
 Worm   110 RSTPTVSRRPSLQKSRIME-PRTDVWPEAKPIGLEERFLKLPDSEDYTRVRQFKIDEKGAVVSRG 173

  Fly  1064 DSLKSRRS---RSNNS-----VASSNSSTEHLTTQQQLSAPASVSARTSLASSRESSTSNPGNGP 1120
            ||.:.:|:   :|:.|     |:.|..|.....::.:.|.|. :|...:..:..|.:.::..:..
 Worm   174 DSFRRKRTPTYKSDKSPSPFPVSVSTDSARGSRSESEASEPL-ISDDVAKMTVNEMTNASTSHKT 237

  Fly  1121 YRVLMLGGPAVGKSSLVSQFMTSEYLHAYDTSIDDESGEKAVSVLLSGEESELIFIDHGYTEMTP 1185
            |::.::|....|||||:||.:||||.:|:...|.|.  |..||:.:.|.|.:|:|.:   ::|: 
 Worm   238 YKIYVVGDTGTGKSSLISQLITSEYKNAFADEIQDY--ENTVSICIGGVECDLVFFE---SDMS- 296

  Fly  1186 DECLTNYDPHGYCVIYSAADRSSFSVAEQVLQVLWTNQNIAQKAVILVSNKADLARSRLVTSEEG 1250
            |.|....:.|.:.|:||...:||:..|...|:::...........::..||.||.|.|.||.:|.
 Worm   297 DPCWLTNEIHAFLVVYSIDSKSSWKQAMVALEMIRDRPGTRNLPTLVAGNKIDLERKRTVTKQEV 361

  Fly  1251 KAMATAYDCKFIETSVGINHNVDELLVGLLSQIR------LKLENPEKSR---DLFRKRSIRKSK 1306
            :|...|...:..|.||.::|:||:|||||:::|:      ..|:.|....   |.|.....|.|:
 Worm   362 RAAKAAMGFEHFEISVALDHDVDDLLVGLVAEIQEAFAPESVLQKPSPRHHPIDDFHSAIRRYSQ 426

  Fly  1307 RRACSPLN----AGCLNANTPLGPLGEAVATPPGSAQSSPR 1343
            |:..:|||    ..|    |.|.|.|...........||||
 Worm   427 RKKKAPLNDLEGGKC----TMLSPTGLFAKFKNWRRGSSPR 463

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rgk1NP_725875.3 DUF2967 459..715 CDD:288079
P-loop_NTPase 1121..1379 CDD:304359 76/236 (32%)
small_GTPase 1121..1286 CDD:197466 57/170 (34%)
Y52B11A.4NP_001379254.1 P-loop_NTPase 238..>394 CDD:422963 56/161 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 98 1.000 Domainoid score I4492
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm14532
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45775
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.