DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rgk1 and REM2

DIOPT Version :9

Sequence 1:NP_725875.3 Gene:Rgk1 / 14462605 FlyBaseID:FBgn0264753 Length:1379 Species:Drosophila melanogaster
Sequence 2:XP_016876547.1 Gene:REM2 / 161253 HGNCID:20248 Length:373 Species:Homo sapiens


Alignment Length:563 Identity:129/563 - (22%)
Similarity:205/563 - (36%) Gaps:211/563 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   836 SPTDSARRRSFKNKQRHQKEEHFYIQTEDRSGTAAGNGPINVTANPLEAAAVCKQPRATIVVQQP 900
            :|..::...|.:.:.||.:   |.:          |||.....|.||             :::||
Human     3 TPVQASGDFSVRGQARHSQ---FLL----------GNGHQVGVAGPL-------------ILEQP 41

  Fly   901 SLSLDNTVETLLIKNEGDFISVEQGKELVARKRNSQQLAHPPAHLHHHTQNHAHNHHTLQQQQHQ 965
            .|||.:.||.:               .|:|    |..|   |:|.                    
Human    42 GLSLLHMVEHI---------------PLIA----SFSL---PSHF-------------------- 64

  Fly   966 QQQQQQHKRDENMRQLLDVTNTLTIEELRDFQMRYGSPHHSRSQSVKMPGSRASGRPNQLCLPQQ 1030
                           :|:...||.                .:|:.:.....| ||.|:....|::
Human    65 ---------------ILEADATLL----------------KKSEKLLAELDR-SGLPSAPGAPRR 97

  Fly  1031 RSRVASMPNTGVEEEYYRLRHFSITGKGVVNRGDSLKSRRSRSNNSV-----ASSNSSTEHLTTQ 1090
            |   .|||        ...:|               :.||:::.:.:     |||:.|::.|.:.
Human    98 R---GSMP--------VPYKH---------------QLRRAQAVDELDWPPQASSSGSSDSLGSG 136

  Fly  1091 QQLSAPASVSARTSLASSRESSTSNPGNGPYRVLMLGGPAVGKSSLVSQF--MTSEYLHAYDTSI 1153
            :  :|||.                  .:|.::|:::|...||||:|...|  :..:..|..:...
Human   137 E--AAPAQ------------------KDGIFKVMLVGESGVGKSTLAGTFGGLQGDSAHEPENPA 181

  Fly  1154 DDESGEKAVSVLLSGEESELIFID-------HGYTEMTPDECLTNYDPHGYCVIYSAADRSSFSV 1211
            :|....:   :::..||..|:..|       .|:..   |.||...|  .:.:::|..||.|||.
Human   182 EDTYERR---IMVDKEEVTLVVYDIWEQGDAGGWLR---DHCLQTGD--AFLIVFSVTDRRSFSK 238

  Fly  1212 AEQVLQVLWTNQNIAQKAVILVSNKADLARSRLVTSEEGKAMATAYDCKFIETSVGINHNVDELL 1276
            ..:.|..|...:......||||.||:||||||.|:.|||:.:|....||.||||..::||..||.
Human   239 VPETLLRLRAGRPHHDLPVILVGNKSDLARSREVSLEEGRHLAGTLSCKHIETSAALHHNTRELF 303

  Fly  1277 VGLLSQIRLKLENPEKSRDLFRKRSIRKSKRRACSPLNAGCLNANTPLGPLGEAVATPPGSAQSS 1341
            .|.:.||||:           |.|:....:|.          :..:|.||      .||      
Human   304 EGAVRQIRLR-----------RGRNHAGGQRP----------DPGSPEGP------APP------ 335

  Fly  1342 PRKYRGSRTSTSLKVKGLLGRVWTRDSK-----SKSCENLHVL 1379
                 ..|.|.:.|.|..|..:..|::|     |:||.:|.||
Human   336 -----ARRESLTKKAKRFLANLVPRNAKFFKQRSRSCHDLSVL 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rgk1NP_725875.3 DUF2967 459..715 CDD:288079
P-loop_NTPase 1121..1379 CDD:304359 78/271 (29%)
small_GTPase 1121..1286 CDD:197466 58/173 (34%)
REM2XP_016876547.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D301527at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45775
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X743
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
55.020

Return to query results.
Submit another query.