DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rgk1 and Rem2

DIOPT Version :9

Sequence 1:NP_725875.3 Gene:Rgk1 / 14462605 FlyBaseID:FBgn0264753 Length:1379 Species:Drosophila melanogaster
Sequence 2:NP_542764.2 Gene:Rem2 / 140743 MGIID:2155260 Length:341 Species:Mus musculus


Alignment Length:310 Identity:90/310 - (29%)
Similarity:134/310 - (43%) Gaps:76/310 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly  1092 QLSAPASVS---ARTSLASSRESSTSNPGNGPYRVLMLGGPAVGKSSLVSQFMTSEYLHAYDTSI 1153
            :|..|...|   :..||.|...:.|..  :|.::|:::|...||||:|...|...:..||::...
Mouse    86 ELDWPPQASPSGSSDSLGSGEAALTQK--DGVFKVMLVGESGVGKSTLAGTFGGLQGDHAHEMEN 148

  Fly  1154 DDESGEKAVSVLLSGEESELIFID-------HGYTEMTPDECLTNYDPHGYCVIYSAADRSSFSV 1211
            .:::.|:  .:::..||..||..|       .|:.:   |.||...|  .:.:::|..||.|||.
Mouse   149 SEDTYER--RIMVDKEEVTLIVYDIWEQGDAGGWLQ---DHCLQTGD--AFLIVFSVTDRRSFSK 206

  Fly  1212 AEQVLQVLWTNQNIAQKAVILVSNKADLARSRLVTSEEGKAMATAYDCKFIETSVGINHNVDELL 1276
            ..:.|..|...:......||||.||:||||||.|:.|||:.:|....||.||||..::||..||.
Mouse   207 VPETLLRLRAGRPHHDLPVILVGNKSDLARSREVSLEEGRHLAGTLSCKHIETSAALHHNTRELF 271

  Fly  1277 VGLLSQIRLKL-------ENPEKSRDLFRKRSIRKSKRRACSPLNAGCLNANTPLGPLGEAVATP 1334
            .|.:.||||:.       :.||.|                            :|.||      .|
Mouse   272 EGAVRQIRLRRGRGHAGGQRPEPS----------------------------SPDGP------AP 302

  Fly  1335 PGSAQSSPRKYRGSRTSTSLKVKGLLGRVWTRDSK-----SKSCENLHVL 1379
            |           ..|.|.:.|.|..|..:..|::|     |:||.:|.||
Mouse   303 P-----------TRRESLTKKAKRFLANLVPRNAKFFKQRSRSCHDLSVL 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rgk1NP_725875.3 DUF2967 459..715 CDD:288079
P-loop_NTPase 1121..1379 CDD:304359 80/276 (29%)
small_GTPase 1121..1286 CDD:197466 60/171 (35%)
Rem2NP_542764.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..71
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 84..106 6/19 (32%)
RGK 116..341 CDD:206715 80/276 (29%)
RAS 116..279 CDD:214541 58/169 (34%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 282..309 9/71 (13%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D301527at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8675
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45775
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X743
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.020

Return to query results.
Submit another query.