DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pre-lola-G and mamo

DIOPT Version :9

Sequence 1:NP_001260870.2 Gene:pre-lola-G / 14462577 FlyBaseID:FBgn0264817 Length:436 Species:Drosophila melanogaster
Sequence 2:NP_572932.2 Gene:mamo / 32353 FlyBaseID:FBgn0267033 Length:1553 Species:Drosophila melanogaster


Alignment Length:315 Identity:70/315 - (22%)
Similarity:119/315 - (37%) Gaps:80/315 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 AEQPHRQVSPTSGEILDPSTISAIAVYGTASETASKNLNADEVMRVQNATATRVVGAAAGAAASF 133
            |:.|...:..|:......:|.:|.|...|::.|::.:..|........:.:|... ||||::.:.
  Fly   151 ADSPAAALDATAATQAATATATATAAAATSTSTSATSAAATAAATAATSASTTAT-AAAGSSNTT 214

  Fly   134 HPRPKYTLKTAASSTEHTTAIPTSVLVANSAAALTPKPQAAVIA-----------------EALM 181
            ......|..|.|::...|.|..:|..|.::|||......|:.:|                 ||..
  Fly   215 TTTAATTTATCATAATSTAATSSSSSVTSAAAAAAAAASASGVAHSEEATSSSSSTGGQKREASD 279

  Fly   182 RNG---------LH----------NFQQQLRAQEILRQQTPHRRIKEENDVEIAGGDITPTKILE 227
            |:.         :|          ..|:|.:|.|:|.::...|.:|:|.|.::            
  Fly   280 RSSPTPAKRSSRMHPADKVDVAEDREQEQNQADELLSEELLGRNLKDEEDDDV------------ 332

  Fly   228 NLLRKQQERDLRHSECENEPGYSTEDDEEGRYHAFDDIHLME---------------QSGGKFGN 277
            :.|.:.:|..||..:.:::    .||:||......|   |.:               |.|   |:
  Fly   333 DELDENEETKLRGRDEDDD----DEDEEEDTPMPLD---LYQRPNVEPKSAAAATAAQQG---GS 387

  Fly   278 NSGMGMFNANAHGGSASSI-----LDAHQAFRNLEFTLSDYGGSSSNGSTTSPNG 327
            ||..|..|| .|..|:|:.     .:.:.:..|...|.|....:||||.|.|..|
  Fly   388 NSLSGSSNA-CHTNSSSNSNNNNNNNNNSSSNNNNNTSSGKTSASSNGGTASSGG 441

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pre-lola-GNP_001260870.2 C2H2 Zn finger 338..358 CDD:275368
zf-H2C2_5 366..389 CDD:290620
C2H2 Zn finger 368..388 CDD:275368
mamoNP_572932.2 BTB 21..118 CDD:279045
BTB 32..118 CDD:197585
C2H2 Zn finger 1082..1105 CDD:275368
C2H2 Zn finger 1116..1137 CDD:275368
C2H2 Zn finger 1149..1169 CDD:275368
zf-C2H2 1469..1491 CDD:278523
C2H2 Zn finger 1471..1491 CDD:275368
zf-H2C2_2 1483..1506 CDD:290200
C2H2 Zn finger 1499..1519 CDD:275368
zf-H2C2_2 1511..1536 CDD:290200
C2H2 Zn finger 1527..1547 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000141
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.