| Sequence 1: | NP_001014633.2 | Gene: | Rpb4 / 14462484 | FlyBaseID: | FBgn0263757 | Length: | 139 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_012395.1 | Gene: | RPB4 / 853301 | SGDID: | S000003676 | Length: | 221 | Species: | Saccharomyces cerevisiae |
| Alignment Length: | 200 | Identity: | 48/200 - (24%) |
|---|---|---|---|
| Similarity: | 79/200 - (39%) | Gaps: | 73/200 - (36%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 11 DEDAADLQFPKEF-----------ENAETLLISEVHMLL--------------------DHRKRQ 44
Fly 45 N------------------------------ESADEEQEFSEVFMK------------TYAYTDS 67
Fly 68 FRKFKNKETIMSARSLLMQKKLHKFELAALGNLCPEAPEEAKALIPSLEGRFEDEELRQILDDIG 132
Fly 133 TKRSL 137 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Rpb4 | NP_001014633.2 | RPOL4c | 22..139 | CDD:128904 | 42/188 (22%) |
| RPB4 | NP_012395.1 | RPB4 | 15..221 | CDD:227575 | 47/199 (24%) |
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C157345515 | |
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_COG5250 | |
| Hieranoid | 1 | 1.000 | - | - | ||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 1 | 1.000 | - | - | FOG0003764 | |
| OrthoInspector | 1 | 1.000 | - | - | oto99346 | |
| orthoMCL | 1 | 0.900 | - | - | OOG6_102742 | |
| Panther | 1 | 1.100 | - | - | LDO | PTHR21297 |
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R1186 |
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 1 | 0.960 | - | - | ||
| 10 | 9.730 | |||||