DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpb4 and TADA2A

DIOPT Version :9

Sequence 1:NP_001014633.2 Gene:Rpb4 / 14462484 FlyBaseID:FBgn0263757 Length:139 Species:Drosophila melanogaster
Sequence 2:NP_001159577.2 Gene:TADA2A / 6871 HGNCID:11531 Length:443 Species:Homo sapiens


Alignment Length:158 Identity:29/158 - (18%)
Similarity:60/158 - (37%) Gaps:40/158 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 MNPVDMVDEDA----------ADLQFPKEFENAETLLISEVHMLLDHRKRQNESADEEQEFSEVF 58
            :..:|.|::|:          .|:...:..|......|...|.|::.||.|.......:|..:::
Human   187 LRDIDFVEDDSDILHALKMAVVDIYHSRLKERQRRKKIIRDHGLINLRKFQLMERRYPKEVQDLY 251

  Fly    59 MKTYAYTDSFRKFK------NKETIMSARSLLMQ-----KKLHKFELAALGNLCPEAPEEAKALI 112
                   ::.|:|.      ..:..:.:.:|..:     |:|.::..|.:.|.|      :....
Human   252 -------ETMRRFARIVGPVEHDKFIESHALEFELRREIKRLQEYRTAGITNFC------SARTY 303

  Fly   113 PSLEGRFEDEEL-RQILDDIGTKRSLQY 139
            ..|:...|:|.| |.:|.::     |||
Human   304 DHLKKTREEERLKRTMLSEV-----LQY 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpb4NP_001014633.2 RPOL4c 22..139 CDD:128904 23/128 (18%)
TADA2ANP_001159577.2 COG5114 28..440 CDD:227445 29/158 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 348..372
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S2493
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.