DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpb4 and POLR2D

DIOPT Version :9

Sequence 1:NP_001014633.2 Gene:Rpb4 / 14462484 FlyBaseID:FBgn0263757 Length:139 Species:Drosophila melanogaster
Sequence 2:NP_004796.1 Gene:POLR2D / 5433 HGNCID:9191 Length:142 Species:Homo sapiens


Alignment Length:130 Identity:101/130 - (77%)
Similarity:112/130 - (86%) Gaps:0/130 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 VDEDAADLQFPKEFENAETLLISEVHMLLDHRKRQNESADEEQEFSEVFMKTYAYTDSFRKFKNK 74
            |:|||:.|.||||||.|||||.|||||||:|||:|||||::|||.|||||||..||..|.:|||:
Human    13 VEEDASQLIFPKEFETAETLLNSEVHMLLEHRKQQNESAEDEQELSEVFMKTLNYTARFSRFKNR 77

  Fly    75 ETIMSARSLLMQKKLHKFELAALGNLCPEAPEEAKALIPSLEGRFEDEELRQILDDIGTKRSLQY 139
            |||.|.||||:||||||||||.|.|||||..||:||||||||||||||||:||||||.||||.||
Human    78 ETIASVRSLLLQKKLHKFELACLANLCPETAEESKALIPSLEGRFEDEELQQILDDIQTKRSFQY 142

  Fly   140  139
            Human   143  142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpb4NP_001014633.2 RPOL4c 22..139 CDD:128904 91/116 (78%)
POLR2DNP_004796.1 RPOL4c 24..141 CDD:128904 92/116 (79%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165156787
Domainoid 1 1.000 163 1.000 Domainoid score I3979
eggNOG 1 0.900 - - E1_COG5250
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H37968
Inparanoid 1 1.050 201 1.000 Inparanoid score I3777
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55689
OrthoDB 1 1.010 - - D1480091at2759
OrthoFinder 1 1.000 - - FOG0003764
OrthoInspector 1 1.000 - - oto89329
orthoMCL 1 0.900 - - OOG6_102742
Panther 1 1.100 - - LDO PTHR21297
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1186
SonicParanoid 1 1.000 - - X4796
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.