DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpb4 and rpb4

DIOPT Version :9

Sequence 1:NP_001014633.2 Gene:Rpb4 / 14462484 FlyBaseID:FBgn0263757 Length:139 Species:Drosophila melanogaster
Sequence 2:NP_595415.1 Gene:rpb4 / 2541011 PomBaseID:SPBC337.14 Length:135 Species:Schizosaccharomyces pombe


Alignment Length:137 Identity:53/137 - (38%)
Similarity:76/137 - (55%) Gaps:8/137 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 PVDMVDEDAADLQFPKEFENAETLLISEVHMLLD----HRKRQNESADEEQEFSEVFMKTYAYTD 66
            |..:.:||||.|:...||||.:.|.:||..:|::    .|.|:...   |...::|..||.||.:
pombe     2 PRAIFEEDAAQLKLGPEFENEDMLTVSEAKILIETVLAQRARETNG---EIPMTDVMKKTVAYFN 63

  Fly    67 SFRKFKNKETIMSARSLLMQKKLHKFELAALGNLCPEAPEEAKALIPSLEGRFEDEELRQILDDI 131
            .|.:||..|...:...:| ..:.||||.|.||.||.|..|||:.|||||..:.:|:.|:.|||::
pombe    64 VFARFKTAEATYACERIL-GNRFHKFERAQLGTLCCEDAEEARTLIPSLANKIDDQNLQGILDEL 127

  Fly   132 GTKRSLQ 138
            .|.|..|
pombe   128 STLRKFQ 134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpb4NP_001014633.2 RPOL4c 22..139 CDD:128904 47/121 (39%)
rpb4NP_595415.1 RPB4 1..134 CDD:227575 52/135 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 67 1.000 Domainoid score I2779
eggNOG 1 0.900 - - E1_COG5250
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 91 1.000 Inparanoid score I1746
OMA 1 1.010 - - QHG55689
OrthoFinder 1 1.000 - - FOG0003764
OrthoInspector 1 1.000 - - oto100928
orthoMCL 1 0.900 - - OOG6_102742
Panther 1 1.100 - - LDO PTHR21297
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1186
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.860

Return to query results.
Submit another query.