DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpb4 and rpb-4

DIOPT Version :9

Sequence 1:NP_001014633.2 Gene:Rpb4 / 14462484 FlyBaseID:FBgn0263757 Length:139 Species:Drosophila melanogaster
Sequence 2:NP_001370397.1 Gene:rpb-4 / 174208 WormBaseID:WBGene00018391 Length:144 Species:Caenorhabditis elegans


Alignment Length:131 Identity:68/131 - (51%)
Similarity:97/131 - (74%) Gaps:2/131 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 VDEDAADLQFPKEFE--NAETLLISEVHMLLDHRKRQNESADEEQEFSEVFMKTYAYTDSFRKFK 72
            |:||||:.:||||||  ..:.||.:||::||:||::.:||.||.:|.||||:||..|.....:||
 Worm    14 VEEDAAECKFPKEFETTTCDALLTAEVYLLLEHRRQSSESKDEIEEMSEVFIKTLNYARRMSRFK 78

  Fly    73 NKETIMSARSLLMQKKLHKFELAALGNLCPEAPEEAKALIPSLEGRFEDEELRQILDDIGTKRSL 137
            |:|||.:.|::..:|.|||||:|.:.|||||..||||||:||||.:.|:.||.::|.|:.:||:.
 Worm    79 NRETIRAVRAIFSEKHLHKFEVAQIANLCPENAEEAKALVPSLENKIEESELEEVLKDLQSKRTF 143

  Fly   138 Q 138
            |
 Worm   144 Q 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpb4NP_001014633.2 RPOL4c 22..139 CDD:128904 60/119 (50%)
rpb-4NP_001370397.1 RPOL4c 25..144 CDD:128904 60/118 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160164736
Domainoid 1 1.000 118 1.000 Domainoid score I3678
eggNOG 1 0.900 - - E1_COG5250
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H37968
Inparanoid 1 1.050 143 1.000 Inparanoid score I3049
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55689
OrthoDB 1 1.010 - - D1480091at2759
OrthoFinder 1 1.000 - - FOG0003764
OrthoInspector 1 1.000 - - oto17656
orthoMCL 1 0.900 - - OOG6_102742
Panther 1 1.100 - - LDO PTHR21297
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1186
SonicParanoid 1 1.000 - - X4796
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1716.800

Return to query results.
Submit another query.