DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG44090 and CG13694

DIOPT Version :10

Sequence 1:NP_001262667.1 Gene:CG44090 / 14462482 FlyBaseID:FBgn0264899 Length:99 Species:Drosophila melanogaster
Sequence 2:NP_608492.1 Gene:CG13694 / 33169 FlyBaseID:FBgn0031219 Length:134 Species:Drosophila melanogaster


Alignment Length:53 Identity:20/53 - (37%)
Similarity:23/53 - (43%) Gaps:15/53 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 EADPIVEQCPSPCTREYRPVCAEWRRHIRGTTRPVISRCTFATECVLNNH-RC 70
            :.||    |...|.|.|||||.  .|:.|        ..||||.|..:|. ||
  Fly    72 DEDP----CERSCPRYYRPVCI--LRNGR--------NMTFATLCEFHNQVRC 110

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG44090NP_001262667.1 KAZAL_FS 26..85 CDD:412159 18/46 (39%)
CG13694NP_608492.1 None

Return to query results.
Submit another query.