DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG44013 and Mup7

DIOPT Version :10

Sequence 1:NP_001262606.1 Gene:CG44013 / 14462476 FlyBaseID:FBgn0264775 Length:219 Species:Drosophila melanogaster
Sequence 2:XP_030108860.1 Gene:Mup7 / 100041658 MGIID:3709615 Length:235 Species:Mus musculus


Alignment Length:66 Identity:18/66 - (27%)
Similarity:30/66 - (45%) Gaps:15/66 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 QSFENLMKHRAGQKYFAEFLKGEYSDENILFWQACEELKREKNAEKIEEKARIIY--EDFISILS 102
            ::|..|:.:.:| |:|...||||.|...|            .|.|:.:...::.:  |.|.:||.
Mouse   138 RAFSTLLVNVSG-KFFEYTLKGEISPGKI------------NNVEQNDMLRKVTFDPEVFFNILL 189

  Fly   103 P 103
            |
Mouse   190 P 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG44013NP_001262606.1 lipocalin_FABP 36..>140 CDD:471979 18/66 (27%)
Mup7XP_030108860.1 lipocalin_MUP-like 23..172 CDD:381203 13/46 (28%)

Return to query results.
Submit another query.