DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG44142 and CG34212

DIOPT Version :10

Sequence 1:NP_001262532.1 Gene:CG44142 / 14462464 FlyBaseID:FBgn0264991 Length:83 Species:Drosophila melanogaster
Sequence 2:NP_001097196.1 Gene:CG34212 / 5740704 FlyBaseID:FBgn0085241 Length:48 Species:Drosophila melanogaster


Alignment Length:42 Identity:19/42 - (45%)
Similarity:32/42 - (76%) Gaps:2/42 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 FLMAILAVSLLMLFSTPATEGTFIIIACMLRSPICPWITTAT 47
            |.:.:||:  ||.|.:|..:|.||::||:|:||:||:.||::
  Fly     8 FYLVVLAI--LMAFLSPTADGCFILLACLLKSPLCPFNTTSS 47

Return to query results.
Submit another query.