DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12256 and zgc:153968

DIOPT Version :9

Sequence 1:NP_650166.2 Gene:CG12256 / 14462452 FlyBaseID:FBgn0038002 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_001070924.1 Gene:zgc:153968 / 768292 ZFINID:ZDB-GENE-061027-211 Length:301 Species:Danio rerio


Alignment Length:241 Identity:83/241 - (34%)
Similarity:118/241 - (48%) Gaps:13/241 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 RVVGGYDVPEDEYVPYQVSMQFLTRSGKMRHFCGGSLIAPNRVLTAAHCVNGQNASRISVVAGIR 110
            |::||.......: |:|||:.::...|.:   |||:||....||:||.|.....||.:.|..|..
Zfish    35 RIIGGQTAMAGSW-PWQVSIHYIPTGGLL---CGGTLINREWVLSAAQCFQKLTASNLVVHLGHL 95

  Fly   111 DLNDSSGFRSQVQSYEMNENYQELVT-SDIAILKIDPPFEL-DEKRVSTIDVSGSDMVGADQEVL 173
            ...|.:...:.......:..|..... :|||:||:..|... |..:...:..|||.: |......
Zfish    96 STGDPNVIHNPASQIINHPKYDSATNKNDIALLKLSTPVSFTDYIKPVCLTASGSSL-GKGAVSW 159

  Fly   174 LTGWGSVFHFGTGPFAKYPTVLQKLDYKTLSNSKCKETMTQL-TDTEICA-LERFGKGACNGDSG 236
            :|||||:...||    ::||.||::....:||..||.....| ||..||| ....|||.|.||.|
Zfish   160 ITGWGSINTGGT----QFPTTLQEVKIPVVSNGDCKSAYGSLITDGMICAGPNEGGKGICMGDGG 220

  Fly   237 GPLVMKSGESYKQVGVVSYGTAFCASNNPDVYTRVSMFDGWIKERM 282
            ||||..|.|.:.|.|:.|:|.......||.|:||||.::.|||.::
Zfish   221 GPLVHNSSEQWIQSGIASFGRGCAQPKNPGVFTRVSEYESWIKSQI 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12256NP_650166.2 Tryp_SPc 46..278 CDD:214473 80/235 (34%)
Tryp_SPc 47..280 CDD:238113 81/236 (34%)
zgc:153968NP_001070924.1 Tryp_SPc 35..262 CDD:214473 80/235 (34%)
Tryp_SPc 36..265 CDD:238113 82/237 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.