DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12256 and Prss32

DIOPT Version :9

Sequence 1:NP_650166.2 Gene:CG12256 / 14462452 FlyBaseID:FBgn0038002 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_081496.2 Gene:Prss32 / 69814 MGIID:1917064 Length:334 Species:Mus musculus


Alignment Length:301 Identity:96/301 - (31%)
Similarity:136/301 - (45%) Gaps:38/301 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 TYF--VLLLSSTLLALGGVQSKPMG-NVIDLDKYFEEADLNSQERVVGGYDVPEDEYVPYQVSMQ 66
            |:|  |||.|..|.......|...| ..||||......  .:..|:|.|.|.....: |:|||::
Mouse    11 TFFPGVLLGSEVLPTDSDSPSTTTGRRSIDLDSVCGRP--RTSGRIVSGQDAQLGRW-PWQVSVR 72

  Fly    67 FLTRSGKMRHFCGGSLIAPNRVLTAAHCVN-GQNASRISVVAG----IRDLNDSSGFRSQVQ--- 123
               .:|  .|.|||||||.:.|||||||.| ||:.|..:|:.|    ..:.|:....|:..|   
Mouse    73 ---ENG--AHVCGGSLIAEDWVLTAAHCFNQGQSLSIYTVLLGTISSYPEDNEPKELRAVAQFIK 132

  Fly   124 --SYEMNENYQELVTSDIAILKIDPPFELDEKRVSTIDVSGSDMVGADQEVLLTGWGSVFHFGTG 186
              ||..:|:    .:.|||::::..|...::..:........|.:.......:||||   |.||.
Mouse   133 HPSYSADEH----SSGDIALVQLASPISFNDYMLPVCLPKPGDPLDPGTMCWVTGWG---HIGTN 190

  Fly   187 PFAKYPTVLQKLDYKTLSNSKCKE---------TMTQLTDTEICA-LERFGKGACNGDSGGPLVM 241
            .....|..||:|....:....|..         |...:.:..:|| .:...|.|||||||||||.
Mouse   191 QPLPPPFTLQELQVPLIDAETCNTYYQENSIPGTEPVILEGMLCAGFQEGKKDACNGDSGGPLVC 255

  Fly   242 KSGESYKQVGVVSYGTAFCASNNPDVYTRVSMFDGWIKERM 282
            ...:.:.|.||||:|:.......|.|||.||::..||:..|
Mouse   256 DINDVWIQAGVVSWGSDCALFKRPGVYTNVSVYISWIQNTM 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12256NP_650166.2 Tryp_SPc 46..278 CDD:214473 80/251 (32%)
Tryp_SPc 47..280 CDD:238113 81/252 (32%)
Prss32NP_081496.2 Tryp_SPc 53..292 CDD:214473 80/251 (32%)
Tryp_SPc 54..295 CDD:238113 81/253 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.