DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12256 and TPSB2

DIOPT Version :9

Sequence 1:NP_650166.2 Gene:CG12256 / 14462452 FlyBaseID:FBgn0038002 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_077078.5 Gene:TPSB2 / 64499 HGNCID:14120 Length:275 Species:Homo sapiens


Alignment Length:299 Identity:89/299 - (29%)
Similarity:133/299 - (44%) Gaps:62/299 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LLSSTLLALGGVQSKPMGNVIDLDKYFEEADLNSQERV--VGGYDVPEDEYVPYQVSMQFLTRSG 72
            :|:..||||..:.|:         .|...|...:.:||  |||.:.|..:: |:|||::  .|..
Human     1 MLNLLLLALPVLASR---------AYAAPAPGQALQRVGIVGGQEAPRSKW-PWQVSLR--VRDR 53

  Fly    73 KMRHFCGGSLIAPNRVLTAAHCVNGQNASRISVVAGIRDLNDSSGFRSQVQSYEMNENYQE---- 133
            ...||||||||.|..||||||||.             .|:.|.:..|  ||..|.:..||:    
Human    54 YWMHFCGGSLIHPQWVLTAAHCVG-------------PDVKDLAALR--VQLREQHLYYQDQLLP 103

  Fly   134 -------------LVTSDIAILKIDPPFELDEKRVSTIDV-SGSDMVGADQEVLLTGWGSVFHFG 184
                         .:.:|||:|:::.|..: ...|.|:.: ..|:.........:||||.|.:..
Human   104 VSRIIVHPQFYTAQIGADIALLELEEPVNV-SSHVHTVTLPPASETFPPGMPCWVTGWGDVDNDE 167

  Fly   185 TGPFAKYPTVLQKLDYKTLSNSKCK----------ETMTQLTDTEICALERFGKGACNGDSGGPL 239
            ..|   .|..|:::....:.|..|.          :.:..:.|..:|| ....:.:|.|||||||
Human   168 RLP---PPFPLKQVKVPIMENHICDAKYHLGAYTGDDVRIVRDDMLCA-GNTRRDSCQGDSGGPL 228

  Fly   240 VMKSGESYKQVGVVSYGTAFCASNNPDVYTRVSMFDGWI 278
            |.|...::.|.||||:|......|.|.:||||:.:..||
Human   229 VCKVNGTWLQAGVVSWGEGCAQPNRPGIYTRVTYYLDWI 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12256NP_650166.2 Tryp_SPc 46..278 CDD:214473 79/261 (30%)
Tryp_SPc 47..280 CDD:238113 80/262 (31%)
TPSB2NP_077078.5 Tryp_SPc 31..268 CDD:238113 79/260 (30%)
Tryp_SPc 31..267 CDD:214473 77/258 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.