DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12256 and zgc:123295

DIOPT Version :9

Sequence 1:NP_650166.2 Gene:CG12256 / 14462452 FlyBaseID:FBgn0038002 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_001032651.1 Gene:zgc:123295 / 641564 ZFINID:ZDB-GENE-051127-11 Length:310 Species:Danio rerio


Alignment Length:281 Identity:82/281 - (29%)
Similarity:140/281 - (49%) Gaps:32/281 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LSSTLLALGGVQSKPMGNVIDLDKYFEEADLNSQERVVGGYDVPEDEYVPYQVSMQFLTRSGKMR 75
            :::.|..:|.:.....|::..|: ....|.||:  ::|||.:.....: |:|||:|..|..|   
Zfish     3 INTALTVVGALLVNIAGSLCQLN-VCGRAPLNT--KIVGGQNAGAGSW-PWQVSLQSPTYGG--- 60

  Fly    76 HFCGGSLIAPNRVLTAAHCVNGQNASRISVVAGIRDLNDSSGFRSQVQSYEMNENYQELVT---- 136
            ||||||||..:.||:||||.. .:...|.|..|::..:.|:       .|::.:...:::.    
Zfish    61 HFCGGSLINKDWVLSAAHCFQ-DSIGTIMVKLGLQSQSGSN-------PYQITKTVVQVINHPNY 117

  Fly   137 ------SDIAILKIDPPFELDEKRVSTIDVSGSDMVGADQEVLLTGWGSVFHFGTGPFAKYPTVL 195
                  :|||::|:|.....::........:..:...|.....:||||.:    :....:.|.:|
Zfish   118 NNPSNDNDIALVKLDSSVTFNDYIEPVCLAAAGNTYAAGTLSWVTGWGKL----SSAANQIPDIL 178

  Fly   196 QKLDYKTLSNSKCKETMT-QLTDTEICA--LERFGKGACNGDSGGPLVMKSGESYKQVGVVSYGT 257
            |:::...:|:|.||.... ::|...|||  |::.||.:|.||||||:|.::|..:.|.|:||:|.
Zfish   179 QEVEIPIVSHSDCKRAYPGEITSNMICAGLLDQGGKDSCQGDSGGPMVSRNGSQWIQSGIVSFGR 243

  Fly   258 AFCASNNPDVYTRVSMFDGWI 278
            .......|.||.|||.:..||
Zfish   244 GCAEPGYPGVYARVSQYQDWI 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12256NP_650166.2 Tryp_SPc 46..278 CDD:214473 73/244 (30%)
Tryp_SPc 47..280 CDD:238113 75/245 (31%)
zgc:123295NP_001032651.1 Tryp_SPc 35..264 CDD:214473 73/244 (30%)
Tryp_SPc 36..264 CDD:238113 73/243 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.