DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12256 and CG18735

DIOPT Version :9

Sequence 1:NP_650166.2 Gene:CG12256 / 14462452 FlyBaseID:FBgn0038002 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster


Alignment Length:271 Identity:82/271 - (30%)
Similarity:128/271 - (47%) Gaps:63/271 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 DLNSQERVVGGYDVPEDEYVPYQVSMQFLTRSGKMRHFCGGSLIAPNRVLTAAHCVNG------- 97
            ::|::.|:|||.:....|| |:.:.:.:..     ..:||.||:.....|||||||||       
  Fly    76 NINTRHRIVGGQETEVHEY-PWMIMLMWFG-----NFYCGASLVNDQYALTAAHCVNGFYHRLIT 134

  Fly    98 -------QNASRISVVAGIRDLNDSSGFRSQVQSYEMNENYQELVTSDIAILKIDPPFELDEKRV 155
                   :..|.:.:|       |....|..:.......|:.    ||||:::.:.|..|     
  Fly   135 VRLLEHNRQDSHVKIV-------DRRVSRVLIHPKYSTRNFD----SDIALIRFNEPVRL----- 183

  Fly   156 STIDVSGSDMVG----------ADQEVLLTGWGSVFHFGTGPFAKYPTVLQKLDYKTLSNSKCKE 210
                  |.||..          |.|..::||||::..  .||.:   ..||:::...||..:|:.
  Fly   184 ------GIDMHPVCMPTPSENYAGQTAVVTGWGALSE--GGPIS---DTLQEVEVPILSQEECRN 237

  Fly   211 T---MTQLTDTEICA--LERFGKGACNGDSGGPL-VMKSGESYKQVGVVSYGTAFCASNNPDVYT 269
            :   .:::||..|||  :|:.||.:|.||||||: |:.||::|:..|:||:|......|.|.|||
  Fly   238 SNYGESKITDNMICAGYVEQGGKDSCQGDSGGPMHVLGSGDAYQLAGIVSWGEGCAKPNAPGVYT 302

  Fly   270 RVSMFDGWIKE 280
            ||..|:.||.|
  Fly   303 RVGSFNDWIAE 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12256NP_650166.2 Tryp_SPc 46..278 CDD:214473 78/261 (30%)
Tryp_SPc 47..280 CDD:238113 79/262 (30%)
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 78/261 (30%)
Tryp_SPc 83..314 CDD:238113 80/264 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.