DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12256 and CG34458

DIOPT Version :9

Sequence 1:NP_650166.2 Gene:CG12256 / 14462452 FlyBaseID:FBgn0038002 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_001097340.1 Gene:CG34458 / 5740868 FlyBaseID:FBgn0085487 Length:257 Species:Drosophila melanogaster


Alignment Length:274 Identity:82/274 - (29%)
Similarity:132/274 - (48%) Gaps:34/274 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LSSTLLALGGVQSKPMGNVIDLDKYFEEADLNSQERVVGGYDVPEDEYVPYQVSMQFLTRSGKMR 75
            ||..|||:..|.|              :.|:..:.|::||......:: |:|||:|.   :|  |
  Fly    10 LSILLLAVTFVHS--------------DMDVAEESRIIGGQFAAPGQF-PHQVSLQL---NG--R 54

  Fly    76 HFCGGSLIAPNRVLTAAHCVNGQNASRISVVAGIRDLNDSSGFRSQVQSYEMNENYQ-ELVTSDI 139
            |.||||||:...::|||||..|||..::..:.|..||:..:|....:..:.::..|. :....|:
  Fly    55 HHCGGSLISDTMIVTAAHCTMGQNPGQMKAIVGTNDLSAGNGQTFNIAQFIIHPRYNPQSQDFDM 119

  Fly   140 AILKIDPPFELDEKRVSTIDVSGSDM-VGADQEVLLTGWGSVFHFGTGPFAKYPTVLQKLDYKTL 203
            :::|:..|..:. ..|.||.::.||. ..||...:::|:|::     ....:.|..|:....:..
  Fly   120 SLIKLSSPVPMG-GAVQTIQLADSDSNYAADTMAMISGFGAI-----NQNLQLPNRLKFAQVQLW 178

  Fly   204 SNSKC-KETMTQLTDTEICALERFGK-GACNGDSGGPLVMKSGESYKQVGVVSYGTAFCASNNPD 266
            |...| .:.:..|||..:||....|: .:|.|||||||.:..    |..||||:|....|...|.
  Fly   179 SRDYCNSQNIPGLTDRMVCAGHPSGQVSSCQGDSGGPLTVDG----KLFGVVSWGFGCGAKGRPA 239

  Fly   267 VYTRVSMFDGWIKE 280
            :||.|.....|||:
  Fly   240 MYTYVGALRSWIKQ 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12256NP_650166.2 Tryp_SPc 46..278 CDD:214473 71/235 (30%)
Tryp_SPc 47..280 CDD:238113 72/236 (31%)
CG34458NP_001097340.1 Tryp_SPc 31..251 CDD:214473 71/235 (30%)
Tryp_SPc 32..254 CDD:238113 73/238 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.