DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12256 and zgc:92313

DIOPT Version :9

Sequence 1:NP_650166.2 Gene:CG12256 / 14462452 FlyBaseID:FBgn0038002 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_001002596.1 Gene:zgc:92313 / 436869 ZFINID:ZDB-GENE-040718-339 Length:309 Species:Danio rerio


Alignment Length:255 Identity:77/255 - (30%)
Similarity:129/255 - (50%) Gaps:37/255 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 RVVGGYDVPEDEYVPYQVSMQFLTRSGKMRHFCGGSLIAPNRVLTAAHCV-NGQNASRISVVAGI 109
            |:|||....:..: |:||.:|    ..|.:|.|||::|:.|.||:||||. |..:.|...:.||.
Zfish    34 RIVGGSSAADGAW-PWQVDIQ----GEKSKHVCGGTIISENWVLSAAHCFPNPNDISGYLIYAGR 93

  Fly   110 RDLNDSSGFRSQVQSYEMNENYQEL------VTSDIAILKIDPPFELDEKRVSTIDVSGSDM-VG 167
            :.||   |:.....|:.::.....|      :..|||::::..||...| |:..:.:..::: ..
Zfish    94 QQLN---GWNPDETSHRISRVVVPLGYTDPQLGQDIALVELATPFVYTE-RIQPVCLPYANVEFT 154

  Fly   168 ADQEVLLTGWGSVFH----FGTGPFAKYPTVLQKLDYKTLSNSKCKET-MTQLTDT------EIC 221
            :|...::||||.:..    .|.||       ||::....:.:..|::. :|..|:.      .:|
Zfish   155 SDMRCMITGWGDIREGVALQGVGP-------LQEVQVPIIDSQICQDMFLTNPTENIDIRPDMMC 212

  Fly   222 A-LERFGKGACNGDSGGPLVMK-SGESYKQVGVVSYGTAFCASNNPDVYTRVSMFDGWIK 279
            | .::.||.:|.|||||||..: |..|:.|.|:||:|.....:|.|.||.:||.|..:|:
Zfish   213 AGFQQGGKDSCQGDSGGPLACQISDGSWVQAGIVSFGLGCAEANRPGVYAKVSSFTNFIQ 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12256NP_650166.2 Tryp_SPc 46..278 CDD:214473 76/252 (30%)
Tryp_SPc 47..280 CDD:238113 76/254 (30%)
zgc:92313NP_001002596.1 Tryp_SPc 34..271 CDD:214473 76/252 (30%)
Tryp_SPc 35..274 CDD:238113 76/254 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.