DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12256 and CG11313

DIOPT Version :9

Sequence 1:NP_650166.2 Gene:CG12256 / 14462452 FlyBaseID:FBgn0038002 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_651821.3 Gene:CG11313 / 43646 FlyBaseID:FBgn0039798 Length:370 Species:Drosophila melanogaster


Alignment Length:275 Identity:68/275 - (24%)
Similarity:119/275 - (43%) Gaps:46/275 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 ERVVGGYDVPEDEYV----------PYQVSMQFLTRSG-KMRHFCGGSLIAPNRVLTAAHCVN-- 96
            :|.:.|.|:..::..          .:.|.:::....| ::|.:|.||||....|:||||||:  
  Fly   103 DRSICGGDIAYNQITKGNETVLTEFAWMVLLEYRPHDGQQLRTYCAGSLINNRYVVTAAHCVSAA 167

  Fly    97 -----GQNASRISVVAGIRDLNDSS------------GFRSQVQSYEMNENY-QELVTSDIAILK 143
                 |..:.|:||..|  :.|.|:            ..:..|:...::|:: ..|..:|||:::
  Fly   168 TRARKGDVSFRVSVRLG--EHNTSAVVDCLNGRCLPEPVQIAVEEIRIHESFGTRLFWNDIALIR 230

  Fly   144 I--DPPFELDEKRVSTIDVSGSDMVGADQEVLLTGWGSVFHFGTGPFAKYPTVLQKLDYKTLSNS 206
            :  :..:....:.|......|.....:.|...:.|||......:.|      |..||....:...
  Fly   231 LAREVAYSPSIRPVCLPSTVGLQNWQSGQAFTVAGWGRTLTSESSP------VKMKLRVTYVEPG 289

  Fly   207 KCKE---TMTQLTDTEICALERFGKGACNGDSGGPLVMKSGESYKQVGVVSYGTAFCASNN-PDV 267
            .|:.   ::..|.|:.:||..|....:|:|||||||:......:...|:||:|.. |.|.. |.|
  Fly   290 LCRRKYASIVVLGDSHLCAEGRSRGDSCDGDSGGPLMAFHEGVWVLGGIVSFGLN-CGSRFWPAV 353

  Fly   268 YTRVSMFDGWIKERM 282
            ||.|..::.||.:.:
  Fly   354 YTNVLSYETWITQNI 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12256NP_650166.2 Tryp_SPc 46..278 CDD:214473 66/268 (25%)
Tryp_SPc 47..280 CDD:238113 67/269 (25%)
CG11313NP_651821.3 CLIP 24..78 CDD:288855
Tryp_SPc 116..367 CDD:238113 65/259 (25%)
Tryp_SPc 116..364 CDD:214473 63/256 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.