DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12256 and CG9733

DIOPT Version :9

Sequence 1:NP_650166.2 Gene:CG12256 / 14462452 FlyBaseID:FBgn0038002 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_651784.2 Gene:CG9733 / 43601 FlyBaseID:FBgn0039759 Length:418 Species:Drosophila melanogaster


Alignment Length:268 Identity:75/268 - (27%)
Similarity:126/268 - (47%) Gaps:39/268 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 QERVVGGYDVPEDEYVPYQVSMQFLTRSGK-MRHFCGGSLIAPNRVLTAAHCVNGQNASRISVVA 107
            :.|:..|.|...:|: |:.|.:::..|||. :...|.||||....|||||||:.|:....:..:.
  Fly   159 RNRIYDGQDTDVNEF-PWMVLLEYRRRSGNGLSTACAGSLINRRYVLTAAHCLTGRIEREVGTLV 222

  Fly   108 GIR----------DLNDSSGFRS-QVQ-----SYEMNENYQELVTS---DIAILKIDPPFELDEK 153
            .:|          |.....|..| :||     ...::|.|.|..::   ||.:::::......: 
  Fly   223 SVRLGEHDTRTAVDCPPGGGSCSPEVQRLGFEEIRVHERYSEKASNQVHDIGLIRMERNVRYSD- 286

  Fly   154 RVSTIDVSGSDMVGAD-----QEVLLTGWGSVFHFGTGPFAKYPTVLQKLDYKTLSNSKCKETMT 213
            .:..|.:..|  ||.:     |:..:.|||........      .|.||:....:..:||::..:
  Fly   287 NIQPICLPSS--VGLESRQSGQQFTVAGWGRTLKMARS------AVKQKVTVNYVDPAKCRQRFS 343

  Fly   214 Q----LTDTEICALERFGKGACNGDSGGPLVMKSGESYKQVGVVSYGTAFCASNNPDVYTRVSMF 274
            |    |..|::||..:|.|.:|:|||||||:....||:...|:||:|......:.|.|||.|:.:
  Fly   344 QIKVNLEPTQLCAGGQFRKDSCDGDSGGPLMRFRDESWVLEGIVSFGYKCGLKDWPGVYTNVAAY 408

  Fly   275 DGWIKERM 282
            |.||::.:
  Fly   409 DIWIRQNV 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12256NP_650166.2 Tryp_SPc 46..278 CDD:214473 73/260 (28%)
Tryp_SPc 47..280 CDD:238113 74/261 (28%)
CG9733NP_651784.2 CLIP 25..78 CDD:288855
Tryp_SPc 161..412 CDD:214473 73/260 (28%)
Tryp_SPc 162..415 CDD:238113 74/262 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.