DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12256 and CG31266

DIOPT Version :9

Sequence 1:NP_650166.2 Gene:CG12256 / 14462452 FlyBaseID:FBgn0038002 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_001138068.1 Gene:CG31266 / 42071 FlyBaseID:FBgn0051266 Length:282 Species:Drosophila melanogaster


Alignment Length:286 Identity:82/286 - (28%)
Similarity:134/286 - (46%) Gaps:30/286 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LLLSSTLLALGG------VQSKPMGNVIDLDKYFEEADLNSQERVVGGYDVPEDEYVPYQVSMQF 67
            :||..|||||.|      ::.:|:..:.::::: ...:...|.||:||....|..: |:..|:| 
  Fly     9 VLLGLTLLALQGPTEAMRMRGEPLPGLANIERH-RSTEAVPQGRVIGGTTAAEGNW-PWIASIQ- 70

  Fly    68 LTRSGKMRHFCGGSLIAPNRVLTAAHCVNGQNASRISVVAGIRDLNDSSGFRSQVQSYEMNENYQ 132
               :....|.||..::....|||||.||.|.....:.||.|..|..|.......|....::.|:.
  Fly    71 ---NAYSYHLCGAIILDETWVLTAASCVAGLRPLNLLVVTGTVDWWDLYAPYYTVSQIHVHCNFD 132

  Fly   133 E-LVTSDIAILKIDPPFELDE--KRVSTIDVSGSDMVGADQEVLLTGWGSVFHFGTGPFAKYPTV 194
            : |..:|||:|::....|.::  |.::..|:   |.:....::...||||....||     |...
  Fly   133 KPLYHNDIALLQLSSKIEFNDVTKNITLADI---DELEEGDKLTFAGWGSSEAMGT-----YGRY 189

  Fly   195 LQKLDYKTLSNSKCKETMTQLTDTE---ICALERFGKGACNGDSGGPLVMKSGESYKQVGVVSYG 256
            ||:.....|....|:|.:....|.:   :|.....|:|||:||:||||:   .|..:.||:.::|
  Fly   190 LQEASGTYLPVDACREKLQNQDDVDLGHVCVQMDAGQGACHGDTGGPLI---DEQQRLVGIGNWG 251

  Fly   257 TAFCASNNPDVYTRVSMFDGWIKERM 282
            .. |....||||.|.:.:..||:..|
  Fly   252 VP-CGRGYPDVYARTAFYHDWIRTTM 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12256NP_650166.2 Tryp_SPc 46..278 CDD:214473 69/237 (29%)
Tryp_SPc 47..280 CDD:238113 70/238 (29%)
CG31266NP_001138068.1 Tryp_SPc 51..272 CDD:214473 69/237 (29%)
Tryp_SPc 52..275 CDD:238113 70/239 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.