DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12256 and CG14892

DIOPT Version :9

Sequence 1:NP_650166.2 Gene:CG12256 / 14462452 FlyBaseID:FBgn0038002 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_650562.1 Gene:CG14892 / 42016 FlyBaseID:FBgn0038447 Length:442 Species:Drosophila melanogaster


Alignment Length:367 Identity:79/367 - (21%)
Similarity:121/367 - (32%) Gaps:141/367 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 RVVGGYDVPEDEYVPYQVSMQFLTRS-GKMRHFCGGSLIAPNRVLTAAHCVNGQNAS-----RIS 104
            |::.|....|.:: |:|.|::.|..| |.:.|:||..||....:|:|||||:....:     ..:
  Fly    80 RIIAGAATNEGQF-PWQASLELLHPSLGFLGHWCGAVLIHQYWILSAAHCVHNDLFNLPIPPLWT 143

  Fly   105 VVAGIRDLNDSSG--FRSQVQSYEMNENYQELVTSDIAILKIDPPFELDEKRVSTI--------- 158
            ||.|..|.:..||  .|..|:...|:..|... ..|:.::|:..|.:|  .|.|.|         
  Fly   144 VVLGEHDRDVESGNEQRIPVEKIVMHHRYHNF-KHDVVLMKLSKPADL--TRASNIRRICLPFLL 205

  Fly   159 ----DVSGSDMV----GADQEVLL----------------------------------------- 174
                |.:.|:.|    .||::||:                                         
  Fly   206 AESPDQAQSETVSPPSSADEDVLIQQLELEDVPEKIDNFLRSVQSRRRYRNVTAPSMKELMNMKI 270

  Fly   175 ------------------------------------------------------------TGWGS 179
                                                                        ||||.
  Fly   271 LSRMRQALAQRSPRSHKRSRRRNDKLMKLGPRRDSDDSAEQKHPKVSDEPKEIAFVDCVATGWGK 335

  Fly   180 VFHFGTGPFAKYPTVLQKLDYKTLSNSKCKE---TMTQLTDTEICALERFGK-GACNGDSGGPLV 240
            ....|     .....|.|.......|.:|::   :...:....:||.:..|: |.|.|||||||.
  Fly   336 ANISG-----DLSNQLLKTQVPLHQNGRCRDAYGSFVNIHGGHLCAGKLNGEGGTCVGDSGGPLQ 395

  Fly   241 MKSGES--YKQVGVVSYGTAFCASNNPDVYTRVSMFDGWIKE 280
            .:....  :..|||.|:|:.......||||||.|.:..||::
  Fly   396 CRLSRDGPWILVGVTSFGSGCALEGFPDVYTRTSYYMKWIED 437

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12256NP_650166.2 Tryp_SPc 46..278 CDD:214473 77/363 (21%)
Tryp_SPc 47..280 CDD:238113 78/364 (21%)
CG14892NP_650562.1 Tryp_SPc 80..435 CDD:214473 77/363 (21%)
Tryp_SPc 81..438 CDD:238113 78/366 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.