DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12256 and CG3916

DIOPT Version :9

Sequence 1:NP_650166.2 Gene:CG12256 / 14462452 FlyBaseID:FBgn0038002 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_650167.1 Gene:CG3916 / 41484 FlyBaseID:FBgn0038003 Length:267 Species:Drosophila melanogaster


Alignment Length:248 Identity:108/248 - (43%)
Similarity:147/248 - (59%) Gaps:25/248 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 SQERVVGGYDVPEDEYVPYQVSMQFLTRSGKMRHFCGGSLIAPNRVLTAAHCVNGQNASRISVVA 107
            |..|:.||..|  :|.||:|||:| :.|.|:.:||||||:::...|||||||:.......:|||.
  Fly    27 SPTRINGGQRV--NETVPFQVSLQ-MQRRGRWQHFCGGSIVSGQHVLTAAHCMEKMKVEDVSVVV 88

  Fly   108 GIRDLN-DSSGFRSQV------QSYEMNENYQELVTSDIAILKIDPPFELDEKRVSTIDVSGSDM 165
            |  .|| .:.|.|.::      ..|.||..    :.:|||::|:.|||.|:...:|||.:.|||.
  Fly    89 G--TLNWKAGGLRHRLVTKHVHPQYSMNPR----IINDIALVKVTPPFRLERSDISTILIGGSDR 147

  Fly   166 VGADQEVLLTGWGSVFHFGTGP---FAKYPTVLQKLDYKTLSNSKCKETMTQLTDTEICALERFG 227
            :|....|.||||||     |.|   .|..|..||.|:|:|:||..|.:...::|..|||||...|
  Fly   148 IGEKVPVRLTGWGS-----TSPSTSSATLPDQLQALNYRTISNEDCNQKGFRVTRNEICALAVQG 207

  Fly   228 KGACNGDSGGPLVMKSGESYKQVGVVSYGTAFCASNNPDVYTRVSMFDGWIKE 280
            :|||.|||||||: :.|:....||:||||::.||...||||||||.|..:|.:
  Fly   208 QGACVGDSGGPLI-RPGKQPHLVGIVSYGSSTCAQGRPDVYTRVSSFLPYISQ 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12256NP_650166.2 Tryp_SPc 46..278 CDD:214473 106/241 (44%)
Tryp_SPc 47..280 CDD:238113 106/242 (44%)
CG3916NP_650167.1 Tryp_SPc 30..257 CDD:214473 106/241 (44%)
Tryp_SPc 31..260 CDD:238113 106/244 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449462
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3C0M5
Homologene 1 1.000 - - H109288
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D526726at33208
OrthoFinder 1 1.000 - - FOG0012677
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.860

Return to query results.
Submit another query.