DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12256 and CG4914

DIOPT Version :9

Sequence 1:NP_650166.2 Gene:CG12256 / 14462452 FlyBaseID:FBgn0038002 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_648711.1 Gene:CG4914 / 39597 FlyBaseID:FBgn0036436 Length:374 Species:Drosophila melanogaster


Alignment Length:258 Identity:77/258 - (29%)
Similarity:119/258 - (46%) Gaps:37/258 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 NSQERVVGGYDVPEDEYVPYQVSMQFLTRSGKMRHFCGGSLIAPNRVLTAAHCVNGQNASRISVV 106
            |.:.|:|||......|| |:...:.:..     |.:|||:||....||||||||.|.....|.|.
  Fly   123 NDESRIVGGTTTGVSEY-PWMARLSYFN-----RFYCGGTLINDRYVLTAAHCVKGFMWFMIKVT 181

  Fly   107 AGIRD-LNDSSG------FRSQVQSYEMNENYQELVTSDIAILKIDP--PFELDEKRVSTIDVSG 162
            .|..| .||...      .|:..|.:..: |:.    :|||:|:::.  |.....:.:....|..
  Fly   182 FGEHDRCNDKERPETRFVLRAFSQKFSFS-NFD----NDIALLRLNDRVPITSFIRPICLPRVEQ 241

  Fly   163 SDMVGADQEVLLTGWGSVFHFGTGPFAKYPTVLQKLDYKTLSNSKC----KETMTQLTDTEICAL 223
            ...:....:.:.||||::...|     |...:||:::...|.|.:|    ..|...:|...:|: 
  Fly   242 RQDLFVGTKAIATGWGTLKEDG-----KPSCLLQEVEVPVLDNDECVAQTNYTQKMITKNMMCS- 300

  Fly   224 ERF----GKGACNGDSGGPLV--MKSGESYKQVGVVSYGTAFCASNNPDVYTRVSMFDGWIKE 280
             .:    |:.:|.||||||||  ....:.::|:|:||:|......|.|.|||||:.:..||.|
  Fly   301 -GYPGVGGRDSCQGDSGGPLVRLRPDDKRFEQIGIVSWGNGCARPNYPGVYTRVTKYLDWIVE 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12256NP_650166.2 Tryp_SPc 46..278 CDD:214473 73/250 (29%)
Tryp_SPc 47..280 CDD:238113 74/251 (29%)
CG4914NP_648711.1 Tryp_SPc 127..360 CDD:214473 73/250 (29%)
Tryp_SPc 128..363 CDD:238113 75/253 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.