DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12256 and CG10663

DIOPT Version :9

Sequence 1:NP_650166.2 Gene:CG12256 / 14462452 FlyBaseID:FBgn0038002 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_001097592.1 Gene:CG10663 / 39421 FlyBaseID:FBgn0036287 Length:748 Species:Drosophila melanogaster


Alignment Length:311 Identity:80/311 - (25%)
Similarity:119/311 - (38%) Gaps:89/311 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 GVTYFVLLLSSTLLALGGVQSKPMGNVIDLDKYFEEADLNSQERVVGGYDVPEDEYVPYQVSMQF 67
            |..|..|.||..::. .|...:.|.|::               :::||....:.|: |:||::  
  Fly   479 GPEYTPLKLSCGIVR-SGTGRRSMSNML---------------KIIGGRAARKGEW-PWQVAI-- 524

  Fly    68 LTRSGKMRHFCGGSLIAPNRVLTAAHCVNGQNASRISVVAGIRDLNDSSGFRSQ---VQSYEMNE 129
            |.|..:.  ||||:||||..||||||||......||    |..:||...|...|   ::||....
  Fly   525 LNRFKEA--FCGGTLIAPRWVLTAAHCVRKVLFVRI----GEHNLNYEDGTEIQLRVMKSYTHPN 583

  Fly   130 NYQELVTSDIAILK---------------IDPPFELDEKRVSTIDVSGSDMVGADQEVLLTGWG- 178
            ..:..|.||:|:|:               :..||:...|.|               :..:.||| 
  Fly   584 FDKRTVDSDVALLRLPKAVNATTWIGYSCLPQPFQALPKNV---------------DCTIIGWGK 633

  Fly   179 ---------SVFHFGTGPFAKYPTVLQKLDYKTLSNSKCKETMTQLTDTE--ICALERFGK-GAC 231
                     ||.|..|.|.              :....|::.....|.|:  .||..:.|. ..|
  Fly   634 RRNRDATGTSVLHKATVPI--------------IPMQNCRKVYYDYTITKNMFCAGHQKGHIDTC 684

  Fly   232 NGDSGGPLV----MKSGESYKQVGVVSYGTAFCASNNPDVYTRVSMFDGWI 278
            .|||||||:    .|....:...|:.|:|......|...:|.:|..:..|:
  Fly   685 AGDSGGPLLCRDTTKPNHPWTIFGITSFGDGCAQRNKFGIYAKVPNYVDWV 735

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12256NP_650166.2 Tryp_SPc 46..278 CDD:214473 71/266 (27%)
Tryp_SPc 47..280 CDD:238113 72/267 (27%)
CG10663NP_001097592.1 Tryp_SPc 506..735 CDD:214473 71/266 (27%)
Tryp_SPc 507..735 CDD:238113 71/265 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.