DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12256 and CG14990

DIOPT Version :9

Sequence 1:NP_650166.2 Gene:CG12256 / 14462452 FlyBaseID:FBgn0038002 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_647856.2 Gene:CG14990 / 38486 FlyBaseID:FBgn0035496 Length:322 Species:Drosophila melanogaster


Alignment Length:267 Identity:83/267 - (31%)
Similarity:121/267 - (45%) Gaps:40/267 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 LNSQERVVGGYDVPEDEYVPYQVSMQF-----LTRSGKMRHFCGGSLIAPNRVLTAAHCVNGQNA 100
            :::...:|....||:|    |....||     |...||  :|..||||||..|||||..|.|:..
  Fly    50 MSNPNGLVANVKVPKD----YSTPGQFPWVVALFSQGK--YFGAGSLIAPEVVLTAASIVVGKTD 108

  Fly   101 SRISVVAGIRDLNDSSGF-----RSQVQSYEMNENYQELVTSDIAILKIDPPFELDEKRVSTIDV 160
            :.|.|.||..:....|.|     |...:..:..|....|..::||:|.:..|||| :..:.||.:
  Fly   109 AEIVVRAGEWNTGQRSEFLPSEDRPVARVVQHREFSYLLGANNIALLFLANPFEL-KSHIRTICL 172

  Fly   161 SGSDMVGADQEVLLTGWGSV-FHFGTGPFAKYPTVLQKLDYKTLSNSKCKETMTQLTDTE----- 219
            .........:..|:||||.| |:     ...|..:.:|::...::.::|::   ||.:|.     
  Fly   173 PSQGRSFDQKRCLVTGWGKVAFN-----DENYSNIQKKIELPMINRAQCQD---QLRNTRLGVSF 229

  Fly   220 ------ICALERFGKGACNGDSGGPLV--MKSGES-YKQVGVVSYGTAFCASNNPDVYTRVSMFD 275
                  |||......|.|.||.|..|.  |::..| |:|.|:|::|......|.|.|||.|.||.
  Fly   230 DLPASLICAGGEKDAGDCLGDGGSALFCPMEADPSRYEQAGIVNWGIGCQEENVPAVYTNVEMFR 294

  Fly   276 GWIKERM 282
            .||.|.|
  Fly   295 DWIYEHM 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12256NP_650166.2 Tryp_SPc 46..278 CDD:214473 79/256 (31%)
Tryp_SPc 47..280 CDD:238113 81/257 (32%)
CG14990NP_647856.2 Tryp_SPc 67..300 CDD:238113 76/243 (31%)
Tryp_SPc 67..297 CDD:214473 74/240 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.