DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12256 and CG30414

DIOPT Version :9

Sequence 1:NP_650166.2 Gene:CG12256 / 14462452 FlyBaseID:FBgn0038002 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_001163264.1 Gene:CG30414 / 37705 FlyBaseID:FBgn0050414 Length:305 Species:Drosophila melanogaster


Alignment Length:242 Identity:73/242 - (30%)
Similarity:108/242 - (44%) Gaps:56/242 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 CGGSLIAPNRVLTAAHCV----------------NGQNASRI--------SVVAGIRDLNDSSGF 118
            ||||||....|||||||:                .|::.||.        .:..|..|.......
  Fly    64 CGGSLITSRFVLTAAHCIVSTHMRVRLGEYKTRFPGKDCSRCVPKSYKLRRIRLGEYDTRFPGKD 128

  Fly   119 RSQVQSYE-------MNENYQELVTSDIAILKIDPPFEL-DEKRVSTIDVSGSDMVGADQEVL-L 174
            ....:|||       ::.:|...:.:||.:|::....:. |..|...:.|.|.   .|:..:. :
  Fly   129 CCVPKSYELAVDRKILHADYNLNLDNDIGLLRMKSFVQYSDYVRPICLLVEGH---MAESPIFNI 190

  Fly   175 TGWGSVFHFGTGPFAKYPTVLQKLDYKTLSNSK---CKETMT-QLTDTEICALERFGKGACNGDS 235
            |||| |.:.||      |:  ::|...|:.|:.   |:...| |:.:::|||... ...||:|||
  Fly   191 TGWG-VTNDGT------PS--RRLQRATVYNTDLHFCRSKFTKQVDESQICAAGT-NSDACHGDS 245

  Fly   236 GGPL---VMKSGESYK-QVGVVSYGTAFCASNNPDVYTRVSMFDGWI 278
            ||||   |..:|.... |.|:||||:|.|.|.:  |||.|:....||
  Fly   246 GGPLSAQVPFAGSWLTFQYGLVSYGSAACHSFS--VYTNVTHHRDWI 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12256NP_650166.2 Tryp_SPc 46..278 CDD:214473 71/240 (30%)
Tryp_SPc 47..280 CDD:238113 73/242 (30%)
CG30414NP_001163264.1 Tryp_SPc 41..290 CDD:214473 71/240 (30%)
Tryp_SPc 41..290 CDD:238113 71/240 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.