DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12256 and CG9294

DIOPT Version :9

Sequence 1:NP_650166.2 Gene:CG12256 / 14462452 FlyBaseID:FBgn0038002 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_995920.1 Gene:CG9294 / 37491 FlyBaseID:FBgn0034666 Length:352 Species:Drosophila melanogaster


Alignment Length:256 Identity:77/256 - (30%)
Similarity:122/256 - (47%) Gaps:34/256 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 LNSQERVVGGYDVPEDEYVPYQVSMQFLTRSGKMRHFCGGSLIAPNRVLTAAHCVNGQNASRISV 105
            :|:..::|||.:....:| |:...:....     |.:|.||||....||||||||.|.....|: 
  Fly    95 INTLYKIVGGQETRVHQY-PWMAVILIYN-----RFYCSGSLINDLYVLTAAHCVEGVPPELIT- 152

  Fly   106 VAGIRDL-------NDSSGFRSQVQSYEMNENYQ-ELVTSDIAILKIDPPFELDEKRVSTIDVSG 162
               :|.|       ||....:..|...:::|.|. ....:|:|:|:::.|.::...|:..|.:. 
  Fly   153 ---LRFLEHNRSHSNDDIVIQRYVSRVKVHELYNPRSFDNDLAVLRLNQPLDMRHHRLRPICLP- 213

  Fly   163 SDMVGADQEV-LLTGWGSVFHFGTGPFAKYPTVLQKLDYKTLSNSKCKETMT----QLTDTEICA 222
            ......|.|: ::.|||:....|.|     ...|:::|...|..|:|:...|    |:||..:||
  Fly   214 VQSYSFDHELGIVAGWGAQREGGFG-----TDTLREVDVVVLPQSECRNGTTYRPGQITDNMMCA 273

  Fly   223 --LERFGKGACNGDSGGPLVMKSGE---SYKQVGVVSYGTAFCASNNPDVYTRVSMFDGWI 278
              :...||.||:|||||||.....|   .|:..|:||:|.......:|.|||||:.:..|:
  Fly   274 GYISEGGKDACSGDSGGPLQTTFDEQPGQYQLAGIVSWGVGCARPQSPGVYTRVNQYLRWL 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12256NP_650166.2 Tryp_SPc 46..278 CDD:214473 75/249 (30%)
Tryp_SPc 47..280 CDD:238113 76/250 (30%)
CG9294NP_995920.1 Tryp_SPc 100..333 CDD:214473 75/248 (30%)
Tryp_SPc 101..334 CDD:238113 75/248 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.