DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12256 and SPH93

DIOPT Version :9

Sequence 1:NP_650166.2 Gene:CG12256 / 14462452 FlyBaseID:FBgn0038002 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_609840.1 Gene:SPH93 / 35049 FlyBaseID:FBgn0032638 Length:494 Species:Drosophila melanogaster


Alignment Length:226 Identity:66/226 - (29%)
Similarity:113/226 - (50%) Gaps:23/226 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 RHFCGGSLIAPNRVLTAAHCVNGQNASRISVVAGIRDL-NDSSGFRSQVQSYE---MNENYQ-EL 134
            ::..|||||.||.|||.||.|. ...:.:.|.||..|| :|...|.|:.:..|   ::|.:. :.
  Fly   268 QYLAGGSLIQPNVVLTVAHRVI-TIETELVVRAGDWDLKSDREIFLSEQREVERAVIHEGFDFKS 331

  Fly   135 VTSDIAILKIDPPFELDEKRVSTIDVSGSDMVGADQEVLLTGWGSVFHFGTGPFAKYPTVLQKLD 199
            ..:::|:|.::.||:|:: .:.||.:...:...|.:...:.|||.:.:    ...:|.|||:|:.
  Fly   332 GANNLALLFLNSPFKLND-HIRTICLPTPNKSFAGRRCTVAGWGKMRY----EDQRYSTVLKKVQ 391

  Fly   200 YKTLSNSKCKETMT--------QLTDTEICALERFGKGACNGDSGGPLVMK-SGES---YKQVGV 252
            ...::.:.|::.:.        :|....|||....|:..|.||.|..|... .||:   |:|.|:
  Fly   392 LLVVNRNVCEKFLRSTRLGAKFELPKNIICAGGELGRDTCTGDGGSALFCSIGGENSGVYEQAGI 456

  Fly   253 VSYGTAFCASNNPDVYTRVSMFDGWIKERMV 283
            |::|........|.:||.||.|..||.|:::
  Fly   457 VNWGVGCGQEGIPAIYTEVSKFTNWITEKLL 487

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12256NP_650166.2 Tryp_SPc 46..278 CDD:214473 63/219 (29%)
Tryp_SPc 47..280 CDD:238113 65/221 (29%)
SPH93NP_609840.1 GRP <136..189 CDD:254089
Tryp_SPc 250..485 CDD:238113 65/222 (29%)
Tryp_SPc 252..482 CDD:214473 63/219 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.