DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12256 and CG18478

DIOPT Version :9

Sequence 1:NP_650166.2 Gene:CG12256 / 14462452 FlyBaseID:FBgn0038002 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_609764.1 Gene:CG18478 / 34923 FlyBaseID:FBgn0028517 Length:294 Species:Drosophila melanogaster


Alignment Length:284 Identity:75/284 - (26%)
Similarity:118/284 - (41%) Gaps:62/284 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 DLNSQERVVGGYDVPEDEYVPYQVSMQFLTRSGKMR-----------H----FCGGSLIAPNRVL 89
            :|...|.:..||..|:      .|.:||....|:.:           |    ..|||||.|:.||
  Fly    22 NLQQIEELKCGYGNPD------AVKVQFNVTEGQAKPAEFPWTIAVIHNRSLVGGGSLITPDIVL 80

  Fly    90 TAAHCVNGQNASRISVVAGIRDLNDSSGFRSQVQSYEMNE------------NYQELVTSDIAIL 142
            ||||.:..::...|.|.||..:      :.|.::.|...|            |||. ..:::|:|
  Fly    81 TAAHRIFNKDVEDIVVSAGEWE------YGSALEKYPFEEAFVLKMVIHKSFNYQR-GANNLALL 138

  Fly   143 KIDPPFELDEKRVSTIDVSGSDMVGADQEVLLTGWGSVFHFGTGPFAKYPTVLQKLDYKTLSNSK 207
            .:|..|.|..| ::||.:.......:....::.|||. :.|..   ..|..||:|:|...:....
  Fly   139 FLDREFPLTYK-INTICLPTQKRSLSSTRCIVAGWGK-YQFSD---THYGGVLKKIDLPIVPRHI 198

  Fly   208 CKETMTQLTDTE-----------ICALERFGKGACNGDSGGPL---VMKSGESYKQVGVVSYGTA 258
            |::   ||..|.           |||.......||.||.||.|   :.:..:.::|:|:|::|..
  Fly   199 CQD---QLRKTRLGQNYTLPRGLICAGGEKDNDACTGDGGGALFCPMTEDPKQFEQIGIVNWGVG 260

  Fly   259 FCASNNPDVYTRVSMFDGWIKERM 282
            ....|.|..||.|..|..||.:::
  Fly   261 CKEKNVPATYTDVFEFKPWIVQQI 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12256NP_650166.2 Tryp_SPc 46..278 CDD:214473 71/272 (26%)
Tryp_SPc 47..280 CDD:238113 73/273 (27%)
CG18478NP_609764.1 Tryp_SPc 50..283 CDD:238113 66/247 (27%)
Tryp_SPc 50..280 CDD:214473 64/244 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.