DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12256 and CG5390

DIOPT Version :9

Sequence 1:NP_650166.2 Gene:CG12256 / 14462452 FlyBaseID:FBgn0038002 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_001285802.1 Gene:CG5390 / 34383 FlyBaseID:FBgn0032213 Length:406 Species:Drosophila melanogaster


Alignment Length:265 Identity:78/265 - (29%)
Similarity:118/265 - (44%) Gaps:38/265 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 GYDVP-------------EDEYVPYQVSMQFLTRSGKMRHF-CGGSLIAPNRVLTAAHCVNGQNA 100
            ||..|             |.|:..:...:..|...|.:..: |||:|||||.||||||||:.:..
  Fly   136 GYQNPNGVGFKITGAVNQEAEFGEFPWMLAILREEGNLNLYECGGALIAPNVVLTAAHCVHNKQP 200

  Fly   101 SRISVVAGIRDLNDSSGFRSQVQSYEMNENYQE-----LVTSDIAILKIDPPFELDEKRVSTIDV 160
            |.|.|.||..|....:..|.....|.....|.|     .:.:|:|::.::.||.|.| .:.|:.:
  Fly   201 SSIVVRAGEWDTQTQTEIRRHEDRYVKEIIYHEQFNKGSLYNDVAVMLLESPFTLQE-NIQTVCL 264

  Fly   161 SG-SDMVGADQEVLLTGWG-SVFHFGTGPFAKYPTVLQKLDYKTLSNSKCKETMTQ--------L 215
            .. .|....|: ...|||| :.|    |...:|..:|:|:|...:...:|:..:.:        |
  Fly   265 PNVGDKFDFDR-CYATGWGKNKF----GKDGEYQVILKKVDMPVVPEQQCETNLRETRLGRHFIL 324

  Fly   216 TDTEICALERFGKGACNGDSGGPLVMK-SGES--YKQVGVVSYGTAFCASNNPDVYTRVSMFDGW 277
            .|:.|||.....|..|.||.|.|||.. :|:.  :|..|:|::|......|.|.||..|:....|
  Fly   325 HDSFICAGGEKDKDTCKGDGGSPLVCPIAGQKNRFKSAGIVAWGIGCGEVNIPGVYASVAKLRPW 389

  Fly   278 IKERM 282
            |..::
  Fly   390 IDAKL 394

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12256NP_650166.2 Tryp_SPc 46..278 CDD:214473 76/259 (29%)
Tryp_SPc 47..280 CDD:238113 78/261 (30%)
CG5390NP_001285802.1 Tryp_SPc 153..391 CDD:238113 74/243 (30%)
Tryp_SPc 153..390 CDD:214473 73/242 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.