DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12256 and CG3355

DIOPT Version :9

Sequence 1:NP_650166.2 Gene:CG12256 / 14462452 FlyBaseID:FBgn0038002 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_608848.1 Gene:CG3355 / 33667 FlyBaseID:FBgn0031619 Length:314 Species:Drosophila melanogaster


Alignment Length:248 Identity:82/248 - (33%)
Similarity:131/248 - (52%) Gaps:31/248 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 RVVGGYDVPEDEYVPYQVSMQFLTRSGKMRH----FCGGSLIAPNRVLTAAHCVNGQNASRISVV 106
            |:|||..|..::| |:...:.      |.||    |||||||....||||||||:|   :|..:.
  Fly    75 RIVGGQQVRSNKY-PWTAQLV------KGRHYPRLFCGGSLINDRYVLTAAHCVHG---NRDQIT 129

  Fly   107 AGIRDLNDSS---GFRSQVQSYEMNENYQ-ELVTSDIAILKIDPPFEL-DEKRVSTIDVSGSDMV 166
            ..:..::.||   |...:|....::.||. ..:.:|:|:||::.|..| ...|...:..:..:..
  Fly   130 IRLLQIDRSSRDPGIVRKVVQTTVHPNYDPNRIVNDVALLKLESPVPLTGNMRPVCLPEANHNFD 194

  Fly   167 GADQEVLLTGWGSVFHFGTGPFAKYPTVLQKLDYKTLSNSKCKET--MTQLTDTEICA--LERFG 227
            |  :..::.|||.:...|.  .:.|   ||:::...::|::|::|  ..::.:..:||  :::.|
  Fly   195 G--KTAVVAGWGLIKEGGV--TSNY---LQEVNVPVITNAQCRQTRYKDKIAEVMLCAGLVQQGG 252

  Fly   228 KGACNGDSGGPLVMKSGESYKQVGVVSYGTAFCASNNPDVYTRVSMFDGWIKE 280
            |.||.|||||||::..|. ||..||||:|......|.|.||.|||.|..||::
  Fly   253 KDACQGDSGGPLIVNEGR-YKLAGVVSFGYGCAQKNAPGVYARVSKFLDWIRK 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12256NP_650166.2 Tryp_SPc 46..278 CDD:214473 80/244 (33%)
Tryp_SPc 47..280 CDD:238113 81/245 (33%)
CG3355NP_608848.1 Tryp_SPc 75..302 CDD:214473 80/244 (33%)
Tryp_SPc 76..305 CDD:238113 81/247 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.