DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12256 and CG3117

DIOPT Version :9

Sequence 1:NP_650166.2 Gene:CG12256 / 14462452 FlyBaseID:FBgn0038002 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_608722.2 Gene:CG3117 / 33484 FlyBaseID:FBgn0031471 Length:347 Species:Drosophila melanogaster


Alignment Length:285 Identity:81/285 - (28%)
Similarity:122/285 - (42%) Gaps:36/285 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 LGGVQSKPMGNVIDLDKYFEEADLNSQERVVGGYDVPEDEYVPYQ---VSMQFLTRSGKMRHFCG 79
            :|..:|.|..:|..|.:......|:...:|.|      |:..|.|   |:..|    .|..:..|
  Fly    64 IGMSKSPPQHSVDTLLRTSYPNALDGSPQVFG------DQTKPNQFPWVTALF----AKGSYLGG 118

  Fly    80 GSLIAPNRVLTAAHCVNGQNASRISVVAGIRDLNDSSGF-----RSQVQSYEMNE-NYQELVTSD 138
            ||||.|..||||||.:.|.:.:.|.|.||..||:.|...     |..::..|... ||.. ..:|
  Fly   119 GSLITPGLVLTAAHILAGLSPNDIMVRAGEWDLSSSEKLNPPMDRQVIKIMEHEAFNYSS-GAND 182

  Fly   139 IAILKIDPPFELDEKRVSTIDVSGSDMVGADQEVLLTGWGSVFHFGTGPFAKYPTVLQKLDYKTL 203
            :|:|.:|.|||| ...:.||.:...|.....:...:.|||    ..:.......|:.||:|...:
  Fly   183 LALLFLDSPFEL-RANIQTIRLPIPDKTFDRRICTVAGWG----MRSSTDVDIQTIQQKVDLPVV 242

  Fly   204 SNSKCKETMT--------QLTDTEICALERFGKGACNGDSGGPLVMKSGES---YKQVGVVSYGT 257
            .:|||:..:.        ||..:.:||....|:..|:...|..|.....:.   |:|.|:||:|.
  Fly   243 ESSKCQRQLRLTKMGSNYQLPASLMCAGGEEGRDVCSLFGGFALFCSLDDDPNRYEQAGIVSFGV 307

  Fly   258 AFCASNNPDVYTRVSMFDGWIKERM 282
            ....:|.|..:|.||.|..||...:
  Fly   308 GCGQANVPTTFTHVSKFMEWINPHL 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12256NP_650166.2 Tryp_SPc 46..278 CDD:214473 73/251 (29%)
Tryp_SPc 47..280 CDD:238113 75/252 (30%)
CG3117NP_608722.2 Tryp_SPc 95..329 CDD:238113 73/249 (29%)
Tryp_SPc 95..328 CDD:214473 72/248 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.