DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12256 and CG3117

DIOPT Version :10

Sequence 1:NP_650166.2 Gene:CG12256 / 14462452 FlyBaseID:FBgn0038002 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_608722.2 Gene:CG3117 / 33484 FlyBaseID:FBgn0031471 Length:347 Species:Drosophila melanogaster


Alignment Length:89 Identity:19/89 - (21%)
Similarity:37/89 - (41%) Gaps:27/89 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   224 QQRGHNRSASLDLKLIA------LNKTKASAESQLPPTTLSLWSSHS-------------DPTAQ 269
            :..|.:.||.:::..|:      .::.:.|.|..:.|:|.|..:|.|             .|.|.
  Fly     2 ESAGRSASAGINIAGISNASSAQAHRLEMSTEFFVVPSTASSAASRSTTVRPGGVILAARHPAAA 66

  Fly   270 SISTTTTTTTFASFPATPDSIPPP 293
            :.|::::||.        .|:.||
  Fly    67 TSSSSSSTTR--------QSVTPP 82

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12256NP_650166.2 COG5640 44..282 CDD:444365 16/76 (21%)
CG3117NP_608722.2 Tryp_SPc 95..329 CDD:238113
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.