DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12256 and CG14227

DIOPT Version :9

Sequence 1:NP_650166.2 Gene:CG12256 / 14462452 FlyBaseID:FBgn0038002 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_608345.2 Gene:CG14227 / 32978 FlyBaseID:FBgn0031058 Length:286 Species:Drosophila melanogaster


Alignment Length:245 Identity:68/245 - (27%)
Similarity:101/245 - (41%) Gaps:59/245 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 SGKMRHFCGGSLIAPNRVLTAAHCV----------------NGQNASRISVVAGIRDLND----- 114
            :||.:  |.||||....||||||||                .|||.|     :|.|..|.     
  Fly    65 NGKAK--CSGSLINHRFVLTAAHCVFREAMQVHLGDFDAWNPGQNCS-----SGARLSNAYCVRI 122

  Fly   115 -----SSGF-RSQVQSYEMNENYQELVTSDIAILKIDPPFELDEKRVSTIDVSGSDMVGADQEVL 173
                 .:|| :.|.|.|            ||.:|::....:..: .|..|.:..::.|.|.....
  Fly   123 DKKIVHAGFGKIQAQQY------------DIGLLRMQHAVQYSD-FVRPICLLINEPVAAIDRFQ 174

  Fly   174 LTGWGSVFHFGTGPFAKYPTVLQKLDYKTLSNSKCK-ETMTQLTDTEICALERFGKGACNGDSGG 237
            ||.||:.    ...|...|.||:......:....|. :...|:.:::|| :......||.|||||
  Fly   175 LTVWGTT----AEDFRSIPRVLKHSVGDRIDRELCTLKFQQQVDESQIC-VHTETSHACKGDSGG 234

  Fly   238 PLVMK--SGESYK--QVGVVSYGTAFCASNNPDVYTRVSMFDGWIKERMV 283
            |...|  .|.:|:  |.|::.:|.:.||..:  |.|.|:.:..||.:.:|
  Fly   235 PFSAKILYGGTYRTFQFGIIIFGLSSCAGLS--VCTNVTFYMDWIWDALV 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12256NP_650166.2 Tryp_SPc 46..278 CDD:214473 65/238 (27%)
Tryp_SPc 47..280 CDD:238113 67/240 (28%)
CG14227NP_608345.2 Tryp_SPc 57..277 CDD:214473 65/238 (27%)
Tryp_SPc 57..277 CDD:238113 65/238 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.